Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3868329..3868986 | Replicon | chromosome |
Accession | NZ_LT992502 | ||
Organism | Enterobacter bugandensis isolate EB-247 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A2J7SFN6 |
Locus tag | DG357_RS18660 | Protein ID | WP_028014322.1 |
Coordinates | 3868329..3868739 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V3PWU7 |
Locus tag | DG357_RS18665 | Protein ID | WP_010435322.1 |
Coordinates | 3868720..3868986 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG357_RS18640 | 3864322..3866055 | - | 1734 | WP_041908356.1 | single-stranded-DNA-specific exonuclease RecJ | - |
DG357_RS18645 | 3866061..3866774 | - | 714 | WP_049136419.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
DG357_RS18650 | 3866803..3867699 | - | 897 | WP_028014320.1 | site-specific tyrosine recombinase XerD | - |
DG357_RS18655 | 3867801..3868322 | + | 522 | WP_041908355.1 | flavodoxin FldB | - |
DG357_RS18660 | 3868329..3868739 | - | 411 | WP_028014322.1 | protein YgfX | Toxin |
DG357_RS18665 | 3868720..3868986 | - | 267 | WP_010435322.1 | FAD assembly factor SdhE | Antitoxin |
DG357_RS18670 | 3869281..3870261 | + | 981 | WP_048960833.1 | tRNA-modifying protein YgfZ | - |
DG357_RS18675 | 3870349..3871008 | - | 660 | WP_023331242.1 | hemolysin III family protein | - |
DG357_RS18680 | 3871274..3872005 | + | 732 | WP_028014325.1 | MurR/RpiR family transcriptional regulator | - |
DG357_RS18685 | 3872122..3873555 | + | 1434 | WP_059358111.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16024.98 Da Isoelectric Point: 11.2845
>T294431 WP_028014322.1 NZ_LT992502:c3868739-3868329 [Enterobacter bugandensis]
VVLWQSDLRVSWRSQWMSLLLHGLVAAIVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGVPWMLNAGMMLRLRKVGGGRCQHLWLAADSMDASEWRDLRRMLLQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAIVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGVPWMLNAGMMLRLRKVGGGRCQHLWLAADSMDASEWRDLRRMLLQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J7SFN6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PWU7 |