Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 1735019..1735816 | Replicon | chromosome |
Accession | NZ_LT992502 | ||
Organism | Enterobacter bugandensis isolate EB-247 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | - |
Locus tag | DG357_RS08395 | Protein ID | WP_172616463.1 |
Coordinates | 1735316..1735816 (+) | Length | 167 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | W7PG43 |
Locus tag | DG357_RS08390 | Protein ID | WP_008499829.1 |
Coordinates | 1735019..1735288 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG357_RS08360 | 1730649..1731092 | - | 444 | WP_028012647.1 | helix-turn-helix transcriptional regulator | - |
DG357_RS08365 | 1731245..1732486 | + | 1242 | WP_088204980.1 | bifunctional glucose-1-phosphatase/inositol phosphatase | - |
DG357_RS08370 | 1732520..1732747 | - | 228 | WP_028012649.1 | YccJ family protein | - |
DG357_RS08375 | 1732766..1733362 | - | 597 | WP_041910554.1 | NAD(P)H:quinone oxidoreductase | - |
DG357_RS08380 | 1733753..1733923 | + | 171 | WP_001273664.1 | general stress protein | - |
DG357_RS08385 | 1734040..1734957 | + | 918 | WP_088204981.1 | DMT family transporter | - |
DG357_RS08390 | 1735019..1735288 | + | 270 | WP_008499829.1 | DUF1778 domain-containing protein | Antitoxin |
DG357_RS08395 | 1735316..1735816 | + | 501 | WP_172616463.1 | N-acetyltransferase | Toxin |
DG357_RS08400 | 1735875..1737197 | - | 1323 | WP_048959639.1 | pyrimidine utilization transport protein G | - |
DG357_RS08405 | 1737219..1737713 | - | 495 | WP_028012654.1 | pyrimidine utilization flavin reductase protein F | - |
DG357_RS08410 | 1737723..1738313 | - | 591 | WP_041910551.1 | malonic semialdehyde reductase | - |
DG357_RS08415 | 1738323..1739123 | - | 801 | WP_028012656.1 | pyrimidine utilization protein D | - |
DG357_RS08420 | 1739131..1739517 | - | 387 | WP_088204983.1 | pyrimidine utilization protein C | - |
DG357_RS08425 | 1739529..1740218 | - | 690 | WP_028012657.1 | pyrimidine utilization protein B | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 167 a.a. Molecular weight: 18873.63 Da Isoelectric Point: 8.4785
>T294426 WP_172616463.1 NZ_LT992502:1735316-1735816 [Enterobacter bugandensis]
MFSEGTDYDFGDFDCGEPSLNAFLREHLVRQHNGRILRAYLLKERDHPRVLGYYTLSGSCFERAMLPSKTQQRRIPYLNV
PSVTLGRLAIHKELQGNEWGTTLVAHAMRVVYLASQAVGVHGIFVDALSEQAKRFYLKLGFIPLAGENSHSLFFPTKAIE
RLFEQA
MFSEGTDYDFGDFDCGEPSLNAFLREHLVRQHNGRILRAYLLKERDHPRVLGYYTLSGSCFERAMLPSKTQQRRIPYLNV
PSVTLGRLAIHKELQGNEWGTTLVAHAMRVVYLASQAVGVHGIFVDALSEQAKRFYLKLGFIPLAGENSHSLFFPTKAIE
RLFEQA
Download Length: 501 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|