Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 1602241..1603154 | Replicon | chromosome |
Accession | NZ_LT992502 | ||
Organism | Enterobacter bugandensis isolate EB-247 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | DG357_RS07740 | Protein ID | WP_088204937.1 |
Coordinates | 1602241..1602714 (-) | Length | 158 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | DG357_RS07745 | Protein ID | WP_045261776.1 |
Coordinates | 1602711..1603154 (-) | Length | 148 a.a. |
Genomic Context
Location: 1598400..1599710 (1311 bp)
Type: Others
Protein ID: WP_088204934.1
Type: Others
Protein ID: WP_088204934.1
Location: 1599707..1600642 (936 bp)
Type: Others
Protein ID: WP_088204935.1
Type: Others
Protein ID: WP_088204935.1
Location: 1600656..1601654 (999 bp)
Type: Others
Protein ID: WP_045261779.1
Type: Others
Protein ID: WP_045261779.1
Location: 1601664..1602218 (555 bp)
Type: Others
Protein ID: WP_088204936.1
Type: Others
Protein ID: WP_088204936.1
Location: 1602241..1602714 (474 bp)
Type: Toxin
Protein ID: WP_088204937.1
Type: Toxin
Protein ID: WP_088204937.1
Location: 1602711..1603154 (444 bp)
Type: Antitoxin
Protein ID: WP_045261776.1
Type: Antitoxin
Protein ID: WP_045261776.1
Location: 1603772..1603990 (219 bp)
Type: Others
Protein ID: WP_002211347.1
Type: Others
Protein ID: WP_002211347.1
Location: 1604275..1604979 (705 bp)
Type: Others
Protein ID: WP_041910636.1
Type: Others
Protein ID: WP_041910636.1
Location: 1605025..1606746 (1722 bp)
Type: Others
Protein ID: WP_088204938.1
Type: Others
Protein ID: WP_088204938.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DG357_RS07720 | 1598400..1599710 | + | 1311 | WP_088204934.1 | type I-F CRISPR-associated protein Csy1 | - |
DG357_RS07725 | 1599707..1600642 | + | 936 | WP_088204935.1 | type I-F CRISPR-associated protein Csy2 | - |
DG357_RS07730 | 1600656..1601654 | + | 999 | WP_045261779.1 | type I-F CRISPR-associated protein Csy3 | - |
DG357_RS07735 | 1601664..1602218 | + | 555 | WP_088204936.1 | type I-F CRISPR-associated endoribonuclease Cas6/Csy4 | - |
DG357_RS07740 | 1602241..1602714 | - | 474 | WP_088204937.1 | RES domain-containing protein | Toxin |
DG357_RS07745 | 1602711..1603154 | - | 444 | WP_045261776.1 | DUF2384 domain-containing protein | Antitoxin |
DG357_RS07750 | 1603772..1603990 | - | 219 | WP_002211347.1 | translation initiation factor IF-1 | - |
DG357_RS07755 | 1604275..1604979 | - | 705 | WP_041910636.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
DG357_RS07760 | 1605025..1606746 | - | 1722 | WP_088204938.1 | cysteine/glutathione ABC transporter ATP-binding protein/permease CydC | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 158 a.a. Molecular weight: 17531.88 Da Isoelectric Point: 5.0700
>T294425 WP_088204937.1 NZ_LT992502:c1602714-1602241 [Enterobacter bugandensis]
MIFYRLVTGRYASEAWSGSGANQYGGRWNHKGHPAVYVSTSISLASLEILVHIRKDTVLNQYQLFSIDIPDDQIDYLDKA
WLPEDWQENPAPVSTMDLGTGWLQASSALALILPSCIIPYENNAILNPLHPAFHTALSSVQQMPFIFDTRLAEKTAP
MIFYRLVTGRYASEAWSGSGANQYGGRWNHKGHPAVYVSTSISLASLEILVHIRKDTVLNQYQLFSIDIPDDQIDYLDKA
WLPEDWQENPAPVSTMDLGTGWLQASSALALILPSCIIPYENNAILNPLHPAFHTALSSVQQMPFIFDTRLAEKTAP
Download Length: 474 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16365.72 Da Isoelectric Point: 8.5886
>AT294425 WP_045261776.1 NZ_LT992502:c1603154-1602711 [Enterobacter bugandensis]
MRTWIPAKKPADNALWRYAGLPANRGMRLIEFLNQGLPVSVLDNIHEWTAMSKADILRVTGINERNVARRKSAGRTLTPD
ESERVARFVRVLDAAVDYFGSKEEAWNWLQSPVRGLGNVAPVDLIATETGALEVTDLIGRLEHGVFA
MRTWIPAKKPADNALWRYAGLPANRGMRLIEFLNQGLPVSVLDNIHEWTAMSKADILRVTGINERNVARRKSAGRTLTPD
ESERVARFVRVLDAAVDYFGSKEEAWNWLQSPVRGLGNVAPVDLIATETGALEVTDLIGRLEHGVFA
Download Length: 444 bp