Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1143769..1144389 | Replicon | chromosome |
| Accession | NZ_LT992502 | ||
| Organism | Enterobacter bugandensis isolate EB-247 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A1H8SI38 |
| Locus tag | DG357_RS05485 | Protein ID | WP_008499287.1 |
| Coordinates | 1143769..1143987 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A8E1RNX1 |
| Locus tag | DG357_RS05490 | Protein ID | WP_028012188.1 |
| Coordinates | 1144015..1144389 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DG357_RS05455 | 1139780..1140040 | + | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
| DG357_RS05460 | 1140043..1140183 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| DG357_RS05465 | 1140180..1140890 | - | 711 | WP_088205223.1 | GNAT family N-acetyltransferase | - |
| DG357_RS05470 | 1140992..1142452 | + | 1461 | WP_088205222.1 | PLP-dependent aminotransferase family protein | - |
| DG357_RS05475 | 1142424..1142891 | - | 468 | WP_028012186.1 | membrane protein | - |
| DG357_RS05480 | 1143008..1143559 | - | 552 | WP_028012187.1 | maltose O-acetyltransferase | - |
| DG357_RS05485 | 1143769..1143987 | - | 219 | WP_008499287.1 | hemolysin expression modulator Hha | Toxin |
| DG357_RS05490 | 1144015..1144389 | - | 375 | WP_028012188.1 | Hha toxicity modulator TomB | Antitoxin |
| DG357_RS05495 | 1144899..1148045 | - | 3147 | WP_047367620.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| DG357_RS05500 | 1148068..1149261 | - | 1194 | WP_028012190.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T294424 WP_008499287.1 NZ_LT992502:c1143987-1143769 [Enterobacter bugandensis]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14511.30 Da Isoelectric Point: 4.8886
>AT294424 WP_028012188.1 NZ_LT992502:c1144389-1144015 [Enterobacter bugandensis]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|