Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 504713..505229 | Replicon | chromosome |
| Accession | NZ_LT992502 | ||
| Organism | Enterobacter bugandensis isolate EB-247 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | DG357_RS02475 | Protein ID | WP_088204684.1 |
| Coordinates | 504945..505229 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A8E1RL94 |
| Locus tag | DG357_RS02470 | Protein ID | WP_023331889.1 |
| Coordinates | 504713..504955 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DG357_RS02455 | 500803..501543 | + | 741 | WP_041911457.1 | KDGP aldolase family protein | - |
| DG357_RS02460 | 501569..502705 | + | 1137 | WP_088204685.1 | lactonase family protein | - |
| DG357_RS02465 | 502725..504635 | + | 1911 | WP_048999489.1 | BglG family transcription antiterminator | - |
| DG357_RS02470 | 504713..504955 | + | 243 | WP_023331889.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| DG357_RS02475 | 504945..505229 | + | 285 | WP_088204684.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| DG357_RS02480 | 505233..505697 | - | 465 | WP_088204683.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| DG357_RS02485 | 505783..507921 | - | 2139 | WP_048960133.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| DG357_RS02490 | 508291..508863 | - | 573 | WP_088204682.1 | fructose PTS transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10991.91 Da Isoelectric Point: 10.0526
>T294423 WP_088204684.1 NZ_LT992502:504945-505229 [Enterobacter bugandensis]
MIYELEFDPRALKEWHKLGDTVKCQFKKKLADVLVNPRIESARLHGLSDCYKIKLRSLGYRLVYQVQDNVVTVFVIAIGK
REKSAVYHEANKRL
MIYELEFDPRALKEWHKLGDTVKCQFKKKLADVLVNPRIESARLHGLSDCYKIKLRSLGYRLVYQVQDNVVTVFVIAIGK
REKSAVYHEANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|