Detailed information of TA system TA294402

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/ParE-Phd
• Location: 956936..957483
• Replicon: chromosome
• Accession: NZ_LT992491
• Organism: Vibrio cholerae strain 4295STDY6534200

Toxin (Protein)

• Gene name: relE
• Uniprot ID: -
• Locus tag: HUW69_RS18525
• Protein ID: WP_000229321.1
• Coordinates: 956936..957238 (-)
• Length: 101 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: Q9KM93
• Locus tag: HUW69_RS18530
• Protein ID: WP_000861987.1
• Coordinates: 957226..957483 (-)
• Length: 86 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HUW69_RS18475	952203..952526	-	324	WP_080281225.1	DUF3709 domain-containing protein	-
HUW69_RS19215	952766..952862	-	97	Protein_946	DUF645 family protein	-
HUW69_RS18485	953103..953213	-	111	WP_080007918.1	DUF3265 domain-containing protein	-
HUW69_RS18490	953223..953756	-	534	WP_000118353.1	GNAT family N-acetyltransferase	-
HUW69_RS18495	953753..954154	-	402	WP_174566698.1	DUF1778 domain-containing protein	-
HUW69_RS18500	954255..954731	-	477	WP_050485312.1	DUF2059 domain-containing protein	-
HUW69_RS18505	954960..955139	-	180	WP_029628741.1	DUF645 family protein	-
HUW69_RS19220	955217..955378	-	162	Protein_952	acetyltransferase	-
HUW69_RS18510	955435..955956	-	522	WP_000921693.1	DUF2442 domain-containing protein	-
HUW69_RS18515	955950..956219	-	270	WP_001114075.1	DUF4160 domain-containing protein	-
HUW69_RS18520	956471..956566	-	96	WP_001907607.1	DUF645 family protein	-
HUW69_RS18525	956936..957238	-	303	WP_000229321.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
HUW69_RS18530	957226..957483	-	258	WP_000861987.1	type II toxin-antitoxin system Phd/YefM family antitoxin	Antitoxin
HUW69_RS18535	957734..957913	-	180	WP_000901930.1	DUF645 family protein	-
HUW69_RS18540	958269..958514	+	246	WP_001260801.1	type II toxin-antitoxin system CcdA family antitoxin	-
HUW69_RS18545	958514..958831	+	318	WP_032480890.1	CcdB family protein	-
HUW69_RS18550	958949..959476	-	528	WP_001232638.1	hypothetical protein	-
HUW69_RS18555	959758..960006	-	249	Protein_962	DUF3709 domain-containing protein	-
HUW69_RS18560	960000..960160	-	161	Protein_963	DUF3709 domain-containing protein	-
HUW69_RS18565	960395..960616	-	222	WP_080388406.1	DUF3709 domain-containing protein	-
HUW69_RS18570	960637..960761	-	125	Protein_965	DUF3709 domain-containing protein	-
HUW69_RS18575	960996..961958	+	963	WP_000841995.1	integron integrase IntIA	-
HUW69_RS18580	962038..962391	-	354	WP_001138368.1	50S ribosomal protein L20	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	-	-	806749..965214	158465
	-	inside	Integron	-	-	806749..961958	155209

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (3-87)

Antitoxin

• Type II toxin-antitoxin system, antitoxin Phd/YefM (1-69)

Sequences

Toxin

Protein

• Length: 101 a.a.
• Molecular weight: 11771.68 Da
• Isoelectric Point: 5.1972

>T294402 WP_000229321.1 NZ_LT992491:c957238-956936 [Vibrio cholerae]
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVMRAERDLRRFMLTKQ

Nucleotide

• Length: 303 bp

Antitoxin

Protein

• Length: 86 a.a.
• Molecular weight: 9647.15 Da
• Isoelectric Point: 7.3178

>AT294402 WP_000861987.1 NZ_LT992491:c957483-957226 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK

Nucleotide

• Length: 258 bp

Structures

Antitoxin

• AlphaFold DB: A0A1T4SLM9