Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) relBE/ParE-Phd
Location 956936..957483 Replicon chromosome
Accession NZ_LT992491
Organism Vibrio cholerae strain 4295STDY6534200

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag HUW69_RS18525 Protein ID WP_000229321.1
Coordinates 956936..957238 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9KM93
Locus tag HUW69_RS18530 Protein ID WP_000861987.1
Coordinates 957226..957483 (-) Length 86 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUW69_RS18475 952203..952526 - 324 WP_080281225.1 DUF3709 domain-containing protein -
HUW69_RS19215 952766..952862 - 97 Protein_946 DUF645 family protein -
HUW69_RS18485 953103..953213 - 111 WP_080007918.1 DUF3265 domain-containing protein -
HUW69_RS18490 953223..953756 - 534 WP_000118353.1 GNAT family N-acetyltransferase -
HUW69_RS18495 953753..954154 - 402 WP_174566698.1 DUF1778 domain-containing protein -
HUW69_RS18500 954255..954731 - 477 WP_050485312.1 DUF2059 domain-containing protein -
HUW69_RS18505 954960..955139 - 180 WP_029628741.1 DUF645 family protein -
HUW69_RS19220 955217..955378 - 162 Protein_952 acetyltransferase -
HUW69_RS18510 955435..955956 - 522 WP_000921693.1 DUF2442 domain-containing protein -
HUW69_RS18515 955950..956219 - 270 WP_001114075.1 DUF4160 domain-containing protein -
HUW69_RS18520 956471..956566 - 96 WP_001907607.1 DUF645 family protein -
HUW69_RS18525 956936..957238 - 303 WP_000229321.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
HUW69_RS18530 957226..957483 - 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
HUW69_RS18535 957734..957913 - 180 WP_000901930.1 DUF645 family protein -
HUW69_RS18540 958269..958514 + 246 WP_001260801.1 type II toxin-antitoxin system CcdA family antitoxin -
HUW69_RS18545 958514..958831 + 318 WP_032480890.1 CcdB family protein -
HUW69_RS18550 958949..959476 - 528 WP_001232638.1 hypothetical protein -
HUW69_RS18555 959758..960006 - 249 Protein_962 DUF3709 domain-containing protein -
HUW69_RS18560 960000..960160 - 161 Protein_963 DUF3709 domain-containing protein -
HUW69_RS18565 960395..960616 - 222 WP_080388406.1 DUF3709 domain-containing protein -
HUW69_RS18570 960637..960761 - 125 Protein_965 DUF3709 domain-containing protein -
HUW69_RS18575 960996..961958 + 963 WP_000841995.1 integron integrase IntIA -
HUW69_RS18580 962038..962391 - 354 WP_001138368.1 50S ribosomal protein L20 -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 806749..965214 158465
- inside Integron - - 806749..961958 155209


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 101 a.a.        Molecular weight: 11771.68 Da        Isoelectric Point: 5.1972

>T294402 WP_000229321.1 NZ_LT992491:c957238-956936 [Vibrio cholerae]
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVMRAERDLRRFMLTKQ

Download         Length: 303 bp


Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9647.15 Da        Isoelectric Point: 7.3178

>AT294402 WP_000861987.1 NZ_LT992491:c957483-957226 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK

Download         Length: 258 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure


Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SLM9

References