Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-Phd |
| Location | 956936..957483 | Replicon | chromosome |
| Accession | NZ_LT992491 | ||
| Organism | Vibrio cholerae strain 4295STDY6534200 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | HUW69_RS18525 | Protein ID | WP_000229321.1 |
| Coordinates | 956936..957238 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q9KM93 |
| Locus tag | HUW69_RS18530 | Protein ID | WP_000861987.1 |
| Coordinates | 957226..957483 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HUW69_RS18475 | 952203..952526 | - | 324 | WP_080281225.1 | DUF3709 domain-containing protein | - |
| HUW69_RS19215 | 952766..952862 | - | 97 | Protein_946 | DUF645 family protein | - |
| HUW69_RS18485 | 953103..953213 | - | 111 | WP_080007918.1 | DUF3265 domain-containing protein | - |
| HUW69_RS18490 | 953223..953756 | - | 534 | WP_000118353.1 | GNAT family N-acetyltransferase | - |
| HUW69_RS18495 | 953753..954154 | - | 402 | WP_174566698.1 | DUF1778 domain-containing protein | - |
| HUW69_RS18500 | 954255..954731 | - | 477 | WP_050485312.1 | DUF2059 domain-containing protein | - |
| HUW69_RS18505 | 954960..955139 | - | 180 | WP_029628741.1 | DUF645 family protein | - |
| HUW69_RS19220 | 955217..955378 | - | 162 | Protein_952 | acetyltransferase | - |
| HUW69_RS18510 | 955435..955956 | - | 522 | WP_000921693.1 | DUF2442 domain-containing protein | - |
| HUW69_RS18515 | 955950..956219 | - | 270 | WP_001114075.1 | DUF4160 domain-containing protein | - |
| HUW69_RS18520 | 956471..956566 | - | 96 | WP_001907607.1 | DUF645 family protein | - |
| HUW69_RS18525 | 956936..957238 | - | 303 | WP_000229321.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| HUW69_RS18530 | 957226..957483 | - | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| HUW69_RS18535 | 957734..957913 | - | 180 | WP_000901930.1 | DUF645 family protein | - |
| HUW69_RS18540 | 958269..958514 | + | 246 | WP_001260801.1 | type II toxin-antitoxin system CcdA family antitoxin | - |
| HUW69_RS18545 | 958514..958831 | + | 318 | WP_032480890.1 | CcdB family protein | - |
| HUW69_RS18550 | 958949..959476 | - | 528 | WP_001232638.1 | hypothetical protein | - |
| HUW69_RS18555 | 959758..960006 | - | 249 | Protein_962 | DUF3709 domain-containing protein | - |
| HUW69_RS18560 | 960000..960160 | - | 161 | Protein_963 | DUF3709 domain-containing protein | - |
| HUW69_RS18565 | 960395..960616 | - | 222 | WP_080388406.1 | DUF3709 domain-containing protein | - |
| HUW69_RS18570 | 960637..960761 | - | 125 | Protein_965 | DUF3709 domain-containing protein | - |
| HUW69_RS18575 | 960996..961958 | + | 963 | WP_000841995.1 | integron integrase IntIA | - |
| HUW69_RS18580 | 962038..962391 | - | 354 | WP_001138368.1 | 50S ribosomal protein L20 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 806749..965214 | 158465 | |
| - | inside | Integron | - | - | 806749..961958 | 155209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11771.68 Da Isoelectric Point: 5.1972
>T294402 WP_000229321.1 NZ_LT992491:c957238-956936 [Vibrio cholerae]
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVMRAERDLRRFMLTKQ
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVMRAERDLRRFMLTKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|