Detailed information of TA system TA294400

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): /DUF1778(antitoxin)
• Location: 953223..954154
• Replicon: chromosome
• Accession: NZ_LT992491
• Organism: Vibrio cholerae strain 4295STDY6534200

Toxin (Protein)

• Gene name: -
• Uniprot ID: D7HHI3
• Locus tag: HUW69_RS18490
• Protein ID: WP_000118353.1
• Coordinates: 953223..953756 (-)
• Length: 178 a.a.

Antitoxin (Protein)

• Gene name: -
• Uniprot ID: -
• Locus tag: HUW69_RS18495
• Protein ID: WP_174566698.1
• Coordinates: 953753..954154 (-)
• Length: 134 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HUW69_RS18440	948463..948960	+	498	WP_000982259.1	GNAT family N-acetyltransferase	-
HUW69_RS18445	949161..949340	-	180	WP_002021999.1	DUF645 family protein	-
HUW69_RS18450	949637..950029	-	393	WP_001084999.1	nuclear transport factor 2 family protein	-
HUW69_RS18455	950195..950485	-	291	WP_080033149.1	YkgJ family cysteine cluster protein	-
HUW69_RS18460	950712..951170	-	459	WP_000479758.1	GNAT family N-acetyltransferase	-
HUW69_RS18465	951332..951565	-	234	WP_138041795.1	hypothetical protein	-
HUW69_RS18470	951633..951920	-	288	WP_197744824.1	SHOCT domain-containing protein	-
HUW69_RS18475	952203..952526	-	324	WP_080281225.1	DUF3709 domain-containing protein	-
HUW69_RS19215	952766..952862	-	97	Protein_946	DUF645 family protein	-
HUW69_RS18485	953103..953213	-	111	WP_080007918.1	DUF3265 domain-containing protein	-
HUW69_RS18490	953223..953756	-	534	WP_000118353.1	GNAT family N-acetyltransferase	Toxin
HUW69_RS18495	953753..954154	-	402	WP_174566698.1	DUF1778 domain-containing protein	Antitoxin
HUW69_RS18500	954255..954731	-	477	WP_050485312.1	DUF2059 domain-containing protein	-
HUW69_RS18505	954960..955139	-	180	WP_029628741.1	DUF645 family protein	-
HUW69_RS19220	955217..955378	-	162	Protein_952	acetyltransferase	-
HUW69_RS18510	955435..955956	-	522	WP_000921693.1	DUF2442 domain-containing protein	-
HUW69_RS18515	955950..956219	-	270	WP_001114075.1	DUF4160 domain-containing protein	-
HUW69_RS18520	956471..956566	-	96	WP_001907607.1	DUF645 family protein	-
HUW69_RS18525	956936..957238	-	303	WP_000229321.1	type II toxin-antitoxin system RelE/ParE family toxin	-
HUW69_RS18530	957226..957483	-	258	WP_000861987.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-
HUW69_RS18535	957734..957913	-	180	WP_000901930.1	DUF645 family protein	-
HUW69_RS18540	958269..958514	+	246	WP_001260801.1	type II toxin-antitoxin system CcdA family antitoxin	-
HUW69_RS18545	958514..958831	+	318	WP_032480890.1	CcdB family protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	-	-	806749..965214	158465
	-	inside	Integron	-	-	806749..961958	155209

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• GNAT domain (97-153)

Antitoxin

• Vibrio phage ICP1, Orf50 (49-125)

Sequences

Toxin

Protein

• Length: 178 a.a.
• Molecular weight: 20192.48 Da
• Isoelectric Point: 9.1426

>T294400 WP_000118353.1 NZ_LT992491:c953756-953223 [Vibrio cholerae]
VSWGKEFVELSKSKHDRDSFDCGEQELNTFIKTQAAKHMQAGISRTMVLPSAQPLLNQKFAICAFYSVAPSSISRETLPT
QLAKKLPRYPIPVFLLAQLAVHKEFHGSGLGKVSLIRALKYLWEVNHHMRAYAIVVDCLTDSAQAFYTKFGFEVLCEHNE
RIRMFLPMKTVEQLFNQ

Nucleotide

• Length: 534 bp

Antitoxin

Protein

• Length: 134 a.a.
• Molecular weight: 14933.37 Da
• Isoelectric Point: 7.7413

>AT294400 WP_174566698.1 NZ_LT992491:c954154-953753 [Vibrio cholerae]
MRCQPLRRALYSPSFRKLSVRIECALSLVYNRSTDGMYPYAGGVMATARLDIRLDEELKAKAEKASALLGLKSLTEYVVR
LMDEDATHVIEEHESIMVKDSVFDEFMAACNKVKAPNQALLEAVKFTEKSGIK

Nucleotide

• Length: 402 bp

Structures

Toxin

• AlphaFold DB: D7HHI3