Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 948194..948960 Replicon chromosome
Accession NZ_LT992491
Organism Vibrio cholerae strain 4295STDY6534200

Toxin (Protein)


Gene name - Uniprot ID A0A366AAS0
Locus tag HUW69_RS18440 Protein ID WP_000982259.1
Coordinates 948463..948960 (+) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A366AAF5
Locus tag HUW69_RS18435 Protein ID WP_000246256.1
Coordinates 948194..948466 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUW69_RS18375 943236..943472 - 237 WP_080006745.1 DUF3709 domain-containing protein -
HUW69_RS18380 943450..943632 - 183 Protein_926 hypothetical protein -
HUW69_RS18385 943751..944266 - 516 WP_041051833.1 hypothetical protein -
HUW69_RS18390 944236..944328 - 93 WP_172778973.1 acetyltransferase -
HUW69_RS18395 944385..944966 - 582 WP_032483186.1 nucleotidyltransferase family protein -
HUW69_RS18400 945189..945407 - 219 WP_001973795.1 DUF3709 domain-containing protein -
HUW69_RS18405 945775..946005 + 231 WP_000838533.1 PAS factor family protein -
HUW69_RS18410 946320..946553 - 234 WP_032474821.1 DUF3709 domain-containing protein -
HUW69_RS18415 946550..946734 - 185 Protein_933 DUF3709 domain-containing protein -
HUW69_RS18420 946957..947175 - 219 WP_032472129.1 DUF3709 domain-containing protein -
HUW69_RS18425 947606..947827 - 222 WP_080388406.1 DUF3709 domain-containing protein -
HUW69_RS18430 947848..948008 - 161 Protein_936 DUF3709 domain-containing protein -
HUW69_RS18435 948194..948466 + 273 WP_000246256.1 DUF1778 domain-containing protein Antitoxin
HUW69_RS18440 948463..948960 + 498 WP_000982259.1 GNAT family N-acetyltransferase Toxin
HUW69_RS18445 949161..949340 - 180 WP_002021999.1 DUF645 family protein -
HUW69_RS18450 949637..950029 - 393 WP_001084999.1 nuclear transport factor 2 family protein -
HUW69_RS18455 950195..950485 - 291 WP_080033149.1 YkgJ family cysteine cluster protein -
HUW69_RS18460 950712..951170 - 459 WP_000479758.1 GNAT family N-acetyltransferase -
HUW69_RS18465 951332..951565 - 234 WP_138041795.1 hypothetical protein -
HUW69_RS18470 951633..951920 - 288 WP_197744824.1 SHOCT domain-containing protein -
HUW69_RS18475 952203..952526 - 324 WP_080281225.1 DUF3709 domain-containing protein -
HUW69_RS19215 952766..952862 - 97 Protein_946 DUF645 family protein -
HUW69_RS18485 953103..953213 - 111 WP_080007918.1 DUF3265 domain-containing protein -
HUW69_RS18490 953223..953756 - 534 WP_000118353.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 806749..965214 158465
- inside Integron - - 806749..961958 155209


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-150)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18497.15 Da        Isoelectric Point: 8.7753

>T294399 WP_000982259.1 NZ_LT992491:948463-948960 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RAGLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9713.24 Da        Isoelectric Point: 6.2988

>AT294399 WP_000246256.1 NZ_LT992491:948194-948466 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLTKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQVDAVLLMEALDNPAVANAKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A366AAS0

Antitoxin

Source ID Structure
AlphaFold DB A0A366AAF5

References