294398

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 912596..913124 Replicon chromosome
Accession NZ_LT992491
Organism Vibrio cholerae strain 4295STDY6534200

Toxin (Protein)


Gene name relE Uniprot ID H9L4R3
Locus tag HUW69_RS18100 Protein ID WP_000221352.1
Coordinates 912834..913124 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag HUW69_RS18095 Protein ID WP_002029763.1
Coordinates 912596..912844 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUW69_RS18055 908539..908757 - 219 WP_032472129.1 DUF3709 domain-containing protein -
HUW69_RS18060 909088..909286 - 199 Protein_862 DUF645 family protein -
HUW69_RS18065 909466..909600 - 135 WP_174566681.1 DUF3265 domain-containing protein -
HUW69_RS18070 910347..910607 - 261 WP_161403747.1 DUF3709 domain-containing protein -
HUW69_RS18075 910577..910761 - 185 Protein_865 DUF3709 domain-containing protein -
HUW69_RS18080 910910..911091 - 182 Protein_866 DUF645 family protein -
HUW69_RS18085 911400..911696 - 297 WP_001069046.1 hypothetical protein -
HUW69_RS18090 911850..912389 - 540 WP_029628805.1 hydrolase -
HUW69_RS18095 912596..912844 + 249 WP_002029763.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
HUW69_RS18100 912834..913124 + 291 WP_000221352.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
HUW69_RS18105 913384..913662 - 279 WP_000280327.1 DUF3709 domain-containing protein -
HUW69_RS18110 913949..914131 - 183 WP_032479903.1 DUF645 family protein -
HUW69_RS18115 914440..914829 - 390 WP_174566682.1 VOC family protein -
HUW69_RS18120 915166..915444 - 279 WP_032469024.1 DUF3709 domain-containing protein -
HUW69_RS18125 915671..916249 - 579 WP_001020574.1 DJ-1/PfpI family protein -
HUW69_RS18130 916447..916617 - 171 WP_002022030.1 DUF645 family protein -
HUW69_RS18135 917064..917285 - 222 WP_108315924.1 DUF3709 domain-containing protein -
HUW69_RS18140 917479..917799 - 321 WP_000923339.1 DUF645 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 806749..965214 158465
- inside Integron - - 806749..961958 155209


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11247.23 Da        Isoelectric Point: 10.4678

>T294398 WP_000221352.1 NZ_LT992491:912834-913124 [Vibrio cholerae]
MTYKLEFKKSALKEWKKLAVPLQQQFKKKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8936.34 Da        Isoelectric Point: 4.3308

>AT294398 WP_002029763.1 NZ_LT992491:912596-912844 [Vibrio cholerae]
MTTRILADVAASITEFKANPMKVATSAFGAPVAVLNRNEPAFYCVPASTYEIMMDKLEDLELLAIAKKRLSEDSVSVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB H9L4R3

Antitoxin

Source ID Structure

References