Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 893900..894428 Replicon chromosome
Accession NZ_LT992491
Organism Vibrio cholerae strain 4295STDY6534200

Toxin (Protein)


Gene name relE Uniprot ID H9L4R3
Locus tag HUW69_RS17925 Protein ID WP_000221352.1
Coordinates 894138..894428 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag HUW69_RS17920 Protein ID WP_174566678.1
Coordinates 893900..894148 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUW69_RS17870 888963..889508 - 546 WP_002033333.1 GNAT family N-acetyltransferase -
HUW69_RS17875 889648..890103 - 456 WP_001245329.1 GNAT family N-acetyltransferase -
HUW69_RS17880 890267..890465 - 199 Protein_826 DUF645 family protein -
HUW69_RS17885 890874..891110 - 237 WP_080006745.1 DUF3709 domain-containing protein -
HUW69_RS17890 891088..891270 - 183 Protein_828 hypothetical protein -
HUW69_RS17895 891463..891705 + 243 WP_001107720.1 type II toxin-antitoxin system ParD family antitoxin -
HUW69_RS17900 891702..892001 + 300 WP_000802134.1 type II toxin-antitoxin system RelE/ParE family toxin -
HUW69_RS17905 892039..892359 - 321 WP_050485209.1 DUF645 family protein -
HUW69_RS19190 892716..892812 - 97 Protein_832 DUF645 family protein -
HUW69_RS17915 893195..893671 - 477 WP_050485312.1 DUF2059 domain-containing protein -
HUW69_RS17920 893900..894148 + 249 WP_174566678.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
HUW69_RS17925 894138..894428 + 291 WP_000221352.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
HUW69_RS17930 894700..894921 - 222 WP_080388406.1 DUF3709 domain-containing protein -
HUW69_RS17935 894942..895102 - 161 Protein_837 DUF3709 domain-containing protein -
HUW69_RS17940 895253..895349 - 97 Protein_838 DUF645 family protein -
HUW69_RS17945 895780..895848 - 69 Protein_839 DUF645 family protein -
HUW69_RS17950 896286..896468 - 183 WP_029628681.1 DUF645 family protein -
HUW69_RS17955 896764..897150 - 387 WP_029628680.1 MmcQ/YjbR family DNA-binding protein -
HUW69_RS17960 897292..897819 - 528 WP_029628769.1 hypothetical protein -
HUW69_RS17965 898088..898321 - 234 WP_080281227.1 DUF3709 domain-containing protein -
HUW69_RS17970 898318..898502 - 185 Protein_844 DUF3709 domain-containing protein -
HUW69_RS17975 898724..899002 - 279 WP_029628768.1 DUF3709 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 806749..965214 158465
- inside Integron - - 806749..961958 155209


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11247.23 Da        Isoelectric Point: 10.4678

>T294397 WP_000221352.1 NZ_LT992491:894138-894428 [Vibrio cholerae]
MTYKLEFKKSALKEWKKLAVPLQQQFKKKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8980.35 Da        Isoelectric Point: 4.2264

>AT294397 WP_174566678.1 NZ_LT992491:893900-894148 [Vibrio cholerae]
MTTRILADVAASITEFKANPMKVATSAFGAPVAVLNRNEPAFYCVPASTYEIMMDKLEDLELLDIAKKRLSEDSVSVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB H9L4R3

Antitoxin

Source ID Structure

References