Detailed information of TA system TA294396

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): parDE/ParE-RHH
• Location: 891463..892001
• Replicon: chromosome
• Accession: NZ_LT992491
• Organism: Vibrio cholerae strain 4295STDY6534200

Toxin (Protein)

• Gene name: parE
• Uniprot ID: -
• Locus tag: HUW69_RS17900
• Protein ID: WP_000802134.1
• Coordinates: 891702..892001 (+)
• Length: 100 a.a.

Antitoxin (Protein)

• Gene name: parD
• Uniprot ID: A0A271VK51
• Locus tag: HUW69_RS17895
• Protein ID: WP_001107720.1
• Coordinates: 891463..891705 (+)
• Length: 81 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HUW69_RS17845	886584..887033	-	450	WP_029628783.1	hypothetical protein	-
HUW69_RS17850	887178..887549	-	372	WP_029628782.1	nucleotide pyrophosphohydrolase	-
HUW69_RS19185	887544..887624	-	81	Protein_820	GNAT family N-acetyltransferase	-
HUW69_RS17855	887823..888041	-	219	WP_032472129.1	DUF3709 domain-containing protein	-
HUW69_RS17860	888471..888719	-	249	WP_161768779.1	DUF3709 domain-containing protein	-
HUW69_RS17865	888713..888873	-	161	Protein_823	DUF3709 domain-containing protein	-
HUW69_RS17870	888963..889508	-	546	WP_002033333.1	GNAT family N-acetyltransferase	-
HUW69_RS17875	889648..890103	-	456	WP_001245329.1	GNAT family N-acetyltransferase	-
HUW69_RS17880	890267..890465	-	199	Protein_826	DUF645 family protein	-
HUW69_RS17885	890874..891110	-	237	WP_080006745.1	DUF3709 domain-containing protein	-
HUW69_RS17890	891088..891270	-	183	Protein_828	hypothetical protein	-
HUW69_RS17895	891463..891705	+	243	WP_001107720.1	type II toxin-antitoxin system ParD family antitoxin	Antitoxin
HUW69_RS17900	891702..892001	+	300	WP_000802134.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
HUW69_RS17905	892039..892359	-	321	WP_050485209.1	DUF645 family protein	-
HUW69_RS19190	892716..892812	-	97	Protein_832	DUF645 family protein	-
HUW69_RS17915	893195..893671	-	477	WP_050485312.1	DUF2059 domain-containing protein	-
HUW69_RS17920	893900..894148	+	249	WP_174566678.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-
HUW69_RS17925	894138..894428	+	291	WP_000221352.1	type II toxin-antitoxin system RelE/ParE family toxin	-
HUW69_RS17930	894700..894921	-	222	WP_080388406.1	DUF3709 domain-containing protein	-
HUW69_RS17935	894942..895102	-	161	Protein_837	DUF3709 domain-containing protein	-
HUW69_RS17940	895253..895349	-	97	Protein_838	DUF645 family protein	-
HUW69_RS17945	895780..895848	-	69	Protein_839	DUF645 family protein	-
HUW69_RS17950	896286..896468	-	183	WP_029628681.1	DUF645 family protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Genomic island	-	-	806749..965214	158465
	-	inside	Integron	-	-	806749..961958	155209

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (6-92)

Antitoxin

• Antitoxin ParD (1-79)

Sequences

Toxin

Protein

• Length: 100 a.a.
• Molecular weight: 11601.34 Da
• Isoelectric Point: 9.9232

>T294396 WP_000802134.1 NZ_LT992491:891702-892001 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQIGSQQ
IRVIRILHKSMDVNPIFGA

Nucleotide

• Length: 300 bp

Antitoxin

Protein

• Length: 81 a.a.
• Molecular weight: 8950.82 Da
• Isoelectric Point: 4.1677

>AT294396 WP_001107720.1 NZ_LT992491:891463-891705 [Vibrio cholerae]
MAKNTSITLGEHFDGFITSQIQSGRYGSASEVIRSALRLLENQETKLQSLRQLLVEGEQSGDADYDLDSFINELDSENIR

Nucleotide

• Length: 243 bp

Structures

Antitoxin

• AlphaFold DB: A0A271VK51