Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 891463..892001 | Replicon | chromosome |
| Accession | NZ_LT992491 | ||
| Organism | Vibrio cholerae strain 4295STDY6534200 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | HUW69_RS17900 | Protein ID | WP_000802134.1 |
| Coordinates | 891702..892001 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A271VK51 |
| Locus tag | HUW69_RS17895 | Protein ID | WP_001107720.1 |
| Coordinates | 891463..891705 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HUW69_RS17845 | 886584..887033 | - | 450 | WP_029628783.1 | hypothetical protein | - |
| HUW69_RS17850 | 887178..887549 | - | 372 | WP_029628782.1 | nucleotide pyrophosphohydrolase | - |
| HUW69_RS19185 | 887544..887624 | - | 81 | Protein_820 | GNAT family N-acetyltransferase | - |
| HUW69_RS17855 | 887823..888041 | - | 219 | WP_032472129.1 | DUF3709 domain-containing protein | - |
| HUW69_RS17860 | 888471..888719 | - | 249 | WP_161768779.1 | DUF3709 domain-containing protein | - |
| HUW69_RS17865 | 888713..888873 | - | 161 | Protein_823 | DUF3709 domain-containing protein | - |
| HUW69_RS17870 | 888963..889508 | - | 546 | WP_002033333.1 | GNAT family N-acetyltransferase | - |
| HUW69_RS17875 | 889648..890103 | - | 456 | WP_001245329.1 | GNAT family N-acetyltransferase | - |
| HUW69_RS17880 | 890267..890465 | - | 199 | Protein_826 | DUF645 family protein | - |
| HUW69_RS17885 | 890874..891110 | - | 237 | WP_080006745.1 | DUF3709 domain-containing protein | - |
| HUW69_RS17890 | 891088..891270 | - | 183 | Protein_828 | hypothetical protein | - |
| HUW69_RS17895 | 891463..891705 | + | 243 | WP_001107720.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| HUW69_RS17900 | 891702..892001 | + | 300 | WP_000802134.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| HUW69_RS17905 | 892039..892359 | - | 321 | WP_050485209.1 | DUF645 family protein | - |
| HUW69_RS19190 | 892716..892812 | - | 97 | Protein_832 | DUF645 family protein | - |
| HUW69_RS17915 | 893195..893671 | - | 477 | WP_050485312.1 | DUF2059 domain-containing protein | - |
| HUW69_RS17920 | 893900..894148 | + | 249 | WP_174566678.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| HUW69_RS17925 | 894138..894428 | + | 291 | WP_000221352.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HUW69_RS17930 | 894700..894921 | - | 222 | WP_080388406.1 | DUF3709 domain-containing protein | - |
| HUW69_RS17935 | 894942..895102 | - | 161 | Protein_837 | DUF3709 domain-containing protein | - |
| HUW69_RS17940 | 895253..895349 | - | 97 | Protein_838 | DUF645 family protein | - |
| HUW69_RS17945 | 895780..895848 | - | 69 | Protein_839 | DUF645 family protein | - |
| HUW69_RS17950 | 896286..896468 | - | 183 | WP_029628681.1 | DUF645 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 806749..965214 | 158465 | |
| - | inside | Integron | - | - | 806749..961958 | 155209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11601.34 Da Isoelectric Point: 9.9232
>T294396 WP_000802134.1 NZ_LT992491:891702-892001 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQIGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQIGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|