294395

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc(toxin)
Location 884196..884767 Replicon chromosome
Accession NZ_LT992491
Organism Vibrio cholerae strain 4295STDY6534200

Toxin (Protein)


Gene name doc Uniprot ID Q9KMA2
Locus tag HUW69_RS17820 Protein ID WP_000351248.1
Coordinates 884196..884597 (-) Length 134 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID Q8GNG3
Locus tag HUW69_RS17825 Protein ID WP_001080654.1
Coordinates 884597..884767 (-) Length 57 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUW69_RS17780 880050..880463 - 414 WP_029628733.1 VOC family protein -
HUW69_RS17785 880751..881083 + 333 WP_029628732.1 SEC-C domain-containing protein -
HUW69_RS17790 881271..881633 - 363 WP_000391481.1 hypothetical protein -
HUW69_RS17795 881819..882253 - 435 WP_000256032.1 GNAT family N-acetyltransferase -
HUW69_RS17800 882522..882755 - 234 Protein_809 DUF3709 domain-containing protein -
HUW69_RS17805 882776..882938 - 163 Protein_810 DUF3709 domain-containing protein -
HUW69_RS17810 883161..883397 - 237 WP_080281220.1 DUF3709 domain-containing protein -
HUW69_RS17815 883783..884019 + 237 WP_000772128.1 RNA-binding protein -
HUW69_RS17820 884196..884597 - 402 WP_000351248.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
HUW69_RS17825 884597..884767 - 171 WP_001080654.1 hypothetical protein Antitoxin
HUW69_RS17830 884948..885412 - 465 WP_029628784.1 GNAT family N-acetyltransferase -
HUW69_RS17835 885615..885794 - 180 WP_000901930.1 DUF645 family protein -
HUW69_RS17840 886171..886401 + 231 WP_000838533.1 PAS factor family protein -
HUW69_RS17845 886584..887033 - 450 WP_029628783.1 hypothetical protein -
HUW69_RS17850 887178..887549 - 372 WP_029628782.1 nucleotide pyrophosphohydrolase -
HUW69_RS19185 887544..887624 - 81 Protein_820 GNAT family N-acetyltransferase -
HUW69_RS17855 887823..888041 - 219 WP_032472129.1 DUF3709 domain-containing protein -
HUW69_RS17860 888471..888719 - 249 WP_161768779.1 DUF3709 domain-containing protein -
HUW69_RS17865 888713..888873 - 161 Protein_823 DUF3709 domain-containing protein -
HUW69_RS17870 888963..889508 - 546 WP_002033333.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 806749..965214 158465
- inside Integron - - 806749..961958 155209


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-132)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 14608.71 Da        Isoelectric Point: 4.0128

>T294395 WP_000351248.1 NZ_LT992491:c884597-884196 [Vibrio cholerae]
MDIICFPFERVIEINAFILKTEPGMKGAVDIPKLQGALGRIDNAIVYEGLDDVFEIAAKYTACIAVSHALPDANKRTGLA
VALEYLSLNDFELTQENDLLADAVRDLVIGIINETDFADILYAQYAKEQNSAL

Download         Length: 402 bp

Antitoxin


Download         Length: 57 a.a.        Molecular weight: 6287.35 Da        Isoelectric Point: 10.7274

>AT294395 WP_001080654.1 NZ_LT992491:c884767-884597 [Vibrio cholerae]
MNRKVEAYGVDAVERPKIKASKKLDLTGDAGRQIVKSETKLALRTHQKTFTKLADM

Download         Length: 171 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0PN34

Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SJJ1

References