Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-Phd
Location 850552..851099 Replicon chromosome
Accession NZ_LT992491
Organism Vibrio cholerae strain 4295STDY6534200

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag HUW69_RS17535 Protein ID WP_000818171.1
Coordinates 850552..850854 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9KM93
Locus tag HUW69_RS17540 Protein ID WP_000861987.1
Coordinates 850842..851099 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUW69_RS17490 845977..846225 + 249 WP_002029763.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
HUW69_RS17495 846215..846505 + 291 WP_000221352.1 type II toxin-antitoxin system RelE/ParE family toxin -
HUW69_RS17500 846648..847187 - 540 WP_029628805.1 hydrolase -
HUW69_RS17505 847348..847773 - 426 WP_029628792.1 hypothetical protein -
HUW69_RS17510 848008..848526 - 519 WP_029628793.1 hypothetical protein -
HUW69_RS17515 848701..849240 - 540 WP_029628791.1 hydrolase -
HUW69_RS17520 849549..849776 - 228 WP_001894457.1 DUF1289 domain-containing protein -
HUW69_RS17525 850091..850288 - 198 WP_080006741.1 DUF3709 domain-containing protein -
HUW69_RS19175 850282..850443 - 162 Protein_755 hypothetical protein -
HUW69_RS17535 850552..850854 - 303 WP_000818171.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
HUW69_RS17540 850842..851099 - 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
HUW69_RS17545 851347..851628 - 282 WP_029628685.1 hypothetical protein -
HUW69_RS17550 852712..853533 - 822 WP_084988704.1 hypothetical protein -
HUW69_RS17555 853704..854087 - 384 WP_029628683.1 hypothetical protein -
HUW69_RS17560 854365..854625 - 261 WP_161768776.1 DUF3709 domain-containing protein -
HUW69_RS17565 854619..854801 - 183 WP_113620335.1 DUF3709 domain-containing protein -
HUW69_RS17570 854761..854853 - 93 WP_193791079.1 DUF3265 domain-containing protein -
HUW69_RS17575 854879..855802 - 924 WP_148496366.1 hypothetical protein -
HUW69_RS17580 855868..855969 - 102 WP_113606188.1 DUF3265 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 806749..965214 158465
- inside Integron - - 806749..961958 155209


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11709.57 Da        Isoelectric Point: 4.8838

>T294394 WP_000818171.1 NZ_LT992491:c850854-850552 [Vibrio cholerae]
MAEIVWTEPALSDLNDIAEYIALENVVAAKQLVQTIFTKVERLADFPESGRIPPELEHLNYREVVVNPCRVFYKYDDANV
RILFVMRAERDLRRLMLTKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9647.15 Da        Isoelectric Point: 7.3178

>AT294394 WP_000861987.1 NZ_LT992491:c851099-850842 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SLM9

References