Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 843664..844192 Replicon chromosome
Accession NZ_LT992491
Organism Vibrio cholerae strain 4295STDY6534200

Toxin (Protein)


Gene name relE Uniprot ID A0A0X1KZS6
Locus tag HUW69_RS17460 Protein ID WP_000221354.1
Coordinates 843664..843951 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag HUW69_RS17465 Protein ID WP_001250180.1
Coordinates 843941..844192 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUW69_RS17415 839171..839419 - 249 WP_161768779.1 DUF3709 domain-containing protein -
HUW69_RS17420 839413..839564 - 152 Protein_732 DUF3709 domain-containing protein -
HUW69_RS17425 839671..840540 - 870 WP_029628724.1 hypothetical protein -
HUW69_RS17430 840811..841029 - 219 WP_032472129.1 DUF3709 domain-containing protein -
HUW69_RS17435 841376..841558 - 183 WP_084998671.1 DUF645 family protein -
HUW69_RS17440 841927..842169 + 243 WP_001107720.1 type II toxin-antitoxin system ParD family antitoxin -
HUW69_RS17445 842166..842465 + 300 WP_000802134.1 type II toxin-antitoxin system RelE/ParE family toxin -
HUW69_RS19165 842642..842734 - 93 Protein_738 DUF645 family protein -
HUW69_RS19170 842701..842823 - 123 Protein_739 DUF645 family protein -
HUW69_RS17455 843180..843351 - 172 Protein_740 DUF645 family protein -
HUW69_RS17460 843664..843951 - 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
HUW69_RS17465 843941..844192 - 252 WP_001250180.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
HUW69_RS17470 844396..844815 - 420 WP_029628772.1 hypothetical protein -
HUW69_RS17475 844833..844922 - 90 WP_148528902.1 hypothetical protein -
HUW69_RS17480 844991..845359 - 369 WP_029628726.1 hypothetical protein -
HUW69_RS17485 845370..845669 - 300 WP_029628725.1 hypothetical protein -
HUW69_RS17490 845977..846225 + 249 WP_002029763.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
HUW69_RS17495 846215..846505 + 291 WP_000221352.1 type II toxin-antitoxin system RelE/ParE family toxin -
HUW69_RS17500 846648..847187 - 540 WP_029628805.1 hydrolase -
HUW69_RS17505 847348..847773 - 426 WP_029628792.1 hypothetical protein -
HUW69_RS17510 848008..848526 - 519 WP_029628793.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 806749..965214 158465
- inside Integron - - 806749..961958 155209


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(11-70)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10991.96 Da        Isoelectric Point: 10.4934

>T294392 WP_000221354.1 NZ_LT992491:c843951-843664 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9152.29 Da        Isoelectric Point: 4.0197

>AT294392 WP_001250180.1 NZ_LT992491:c844192-843941 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLSQAVEVNI
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0X1KZS6

Antitoxin

Source ID Structure

References