Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 841927..842465 | Replicon | chromosome |
| Accession | NZ_LT992491 | ||
| Organism | Vibrio cholerae strain 4295STDY6534200 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | HUW69_RS17445 | Protein ID | WP_000802134.1 |
| Coordinates | 842166..842465 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A271VK51 |
| Locus tag | HUW69_RS17440 | Protein ID | WP_001107720.1 |
| Coordinates | 841927..842169 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HUW69_RS17405 | 838072..838270 | - | 199 | Protein_729 | DUF645 family protein | - |
| HUW69_RS17410 | 838571..838855 | - | 285 | WP_000048762.1 | antibiotic biosynthesis monooxygenase | - |
| HUW69_RS17415 | 839171..839419 | - | 249 | WP_161768779.1 | DUF3709 domain-containing protein | - |
| HUW69_RS17420 | 839413..839564 | - | 152 | Protein_732 | DUF3709 domain-containing protein | - |
| HUW69_RS17425 | 839671..840540 | - | 870 | WP_029628724.1 | hypothetical protein | - |
| HUW69_RS17430 | 840811..841029 | - | 219 | WP_032472129.1 | DUF3709 domain-containing protein | - |
| HUW69_RS17435 | 841376..841558 | - | 183 | WP_084998671.1 | DUF645 family protein | - |
| HUW69_RS17440 | 841927..842169 | + | 243 | WP_001107720.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| HUW69_RS17445 | 842166..842465 | + | 300 | WP_000802134.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| HUW69_RS19165 | 842642..842734 | - | 93 | Protein_738 | DUF645 family protein | - |
| HUW69_RS19170 | 842701..842823 | - | 123 | Protein_739 | DUF645 family protein | - |
| HUW69_RS17455 | 843180..843351 | - | 172 | Protein_740 | DUF645 family protein | - |
| HUW69_RS17460 | 843664..843951 | - | 288 | WP_000221354.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HUW69_RS17465 | 843941..844192 | - | 252 | WP_001250180.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| HUW69_RS17470 | 844396..844815 | - | 420 | WP_029628772.1 | hypothetical protein | - |
| HUW69_RS17475 | 844833..844922 | - | 90 | WP_148528902.1 | hypothetical protein | - |
| HUW69_RS17480 | 844991..845359 | - | 369 | WP_029628726.1 | hypothetical protein | - |
| HUW69_RS17485 | 845370..845669 | - | 300 | WP_029628725.1 | hypothetical protein | - |
| HUW69_RS17490 | 845977..846225 | + | 249 | WP_002029763.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| HUW69_RS17495 | 846215..846505 | + | 291 | WP_000221352.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HUW69_RS17500 | 846648..847187 | - | 540 | WP_029628805.1 | hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 806749..965214 | 158465 | |
| - | inside | Integron | - | - | 806749..961958 | 155209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11601.34 Da Isoelectric Point: 9.9232
>T294391 WP_000802134.1 NZ_LT992491:842166-842465 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQIGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQIGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|