Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /GNAT-DUF1778
Location 829621..830387 Replicon chromosome
Accession NZ_LT992491
Organism Vibrio cholerae strain 4295STDY6534200

Toxin (Protein)


Gene name - Uniprot ID A0A366AAS0
Locus tag HUW69_RS17340 Protein ID WP_000982259.1
Coordinates 829890..830387 (+) Length 166 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A366AAF5
Locus tag HUW69_RS17335 Protein ID WP_000246256.1
Coordinates 829621..829893 (+) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUW69_RS17285 824965..825144 - 180 WP_002029767.1 DUF645 family protein -
HUW69_RS17290 825441..825941 - 501 WP_029628695.1 NAD(P)H-dependent oxidoreductase -
HUW69_RS17295 826223..826444 - 222 WP_080388406.1 DUF3709 domain-containing protein -
HUW69_RS17300 826465..826625 - 161 Protein_708 DUF3709 domain-containing protein -
HUW69_RS17305 826776..827024 + 249 WP_002029763.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
HUW69_RS17310 827014..827304 + 291 WP_000221352.1 type II toxin-antitoxin system RelE/ParE family toxin -
HUW69_RS17315 827459..827749 - 291 WP_080033149.1 YkgJ family cysteine cluster protein -
HUW69_RS17320 828015..828110 - 96 WP_001907607.1 DUF645 family protein -
HUW69_RS17325 828519..828698 - 180 WP_002021999.1 DUF645 family protein -
HUW69_RS17330 828995..829387 - 393 WP_001084999.1 nuclear transport factor 2 family protein -
HUW69_RS17335 829621..829893 + 273 WP_000246256.1 DUF1778 domain-containing protein Antitoxin
HUW69_RS17340 829890..830387 + 498 WP_000982259.1 GNAT family N-acetyltransferase Toxin
HUW69_RS17345 830589..830772 - 184 Protein_717 DUF645 family protein -
HUW69_RS17350 830910..832336 + 1427 WP_113606171.1 IS66 family transposase -
HUW69_RS19160 832711..832807 - 97 Protein_719 DUF645 family protein -
HUW69_RS17360 833177..833635 - 459 WP_000479758.1 GNAT family N-acetyltransferase -
HUW69_RS17365 833847..833943 - 97 Protein_721 DUF645 family protein -
HUW69_RS17370 834373..834411 - 39 WP_128974310.1 hypothetical protein -
HUW69_RS17375 834430..834555 - 126 WP_080006744.1 DUF645 family protein -
HUW69_RS17380 834910..835092 - 183 WP_029628681.1 DUF645 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 806749..965214 158465
- inside Integron - - 806749..961958 155209


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(86-150)

Antitoxin

Vibrio phage ICP1, Orf50

(7-86)


Sequences

Toxin        


Download         Length: 166 a.a.        Molecular weight: 18497.15 Da        Isoelectric Point: 8.7753

>T294390 WP_000982259.1 NZ_LT992491:829890-830387 [Vibrio cholerae]
MMNTVLLDKDKHDRNRFNCGTEALNNYLKVMASQQAKKDNTRTFVLEDDNNSAYIIGFYTLTMTPIDLKALPDKLQKKHQ
SSTSGGLIARLAVDDRYKGKGFGEWLLIDALRKLLAASDSVAFPVVIVDAKDGAKHFYERYGFQAFQDAENKLFITIADI
RAGLG

Download         Length: 498 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 9713.24 Da        Isoelectric Point: 6.2988

>AT294390 WP_000246256.1 NZ_LT992491:829621-829893 [Vibrio cholerae]
MATTLPRITARVDVDTQDLLTKAAALAGMSSINSFVLNAAIEKAKQVIEREQALKLSQVDAVLLMEALDNPAVANAKLKL
ASERYESKTQ

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A366AAS0

Antitoxin

Source ID Structure
AlphaFold DB A0A366AAF5

References