294389

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 826776..827304 Replicon chromosome
Accession NZ_LT992491
Organism Vibrio cholerae strain 4295STDY6534200

Toxin (Protein)


Gene name relE Uniprot ID H9L4R3
Locus tag HUW69_RS17310 Protein ID WP_000221352.1
Coordinates 827014..827304 (+) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag HUW69_RS17305 Protein ID WP_002029763.1
Coordinates 826776..827024 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUW69_RS17260 822201..822296 - 96 WP_001907607.1 DUF645 family protein -
HUW69_RS17265 822755..823027 - 273 WP_139804714.1 DUF3709 domain-containing protein -
HUW69_RS17270 823118..823654 - 537 WP_029628698.1 GNAT family N-acetyltransferase -
HUW69_RS17275 823864..823960 - 97 Protein_703 DUF645 family protein -
HUW69_RS17280 824319..824768 - 450 WP_029628696.1 GyrI-like domain-containing protein -
HUW69_RS17285 824965..825144 - 180 WP_002029767.1 DUF645 family protein -
HUW69_RS17290 825441..825941 - 501 WP_029628695.1 NAD(P)H-dependent oxidoreductase -
HUW69_RS17295 826223..826444 - 222 WP_080388406.1 DUF3709 domain-containing protein -
HUW69_RS17300 826465..826625 - 161 Protein_708 DUF3709 domain-containing protein -
HUW69_RS17305 826776..827024 + 249 WP_002029763.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
HUW69_RS17310 827014..827304 + 291 WP_000221352.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
HUW69_RS17315 827459..827749 - 291 WP_080033149.1 YkgJ family cysteine cluster protein -
HUW69_RS17320 828015..828110 - 96 WP_001907607.1 DUF645 family protein -
HUW69_RS17325 828519..828698 - 180 WP_002021999.1 DUF645 family protein -
HUW69_RS17330 828995..829387 - 393 WP_001084999.1 nuclear transport factor 2 family protein -
HUW69_RS17335 829621..829893 + 273 WP_000246256.1 DUF1778 domain-containing protein -
HUW69_RS17340 829890..830387 + 498 WP_000982259.1 GNAT family N-acetyltransferase -
HUW69_RS17345 830589..830772 - 184 Protein_717 DUF645 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 806749..965214 158465
- inside Integron - - 806749..961958 155209


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11247.23 Da        Isoelectric Point: 10.4678

>T294389 WP_000221352.1 NZ_LT992491:827014-827304 [Vibrio cholerae]
MTYKLEFKKSALKEWKKLAVPLQQQFKKKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8936.34 Da        Isoelectric Point: 4.3308

>AT294389 WP_002029763.1 NZ_LT992491:826776-827024 [Vibrio cholerae]
MTTRILADVAASITEFKANPMKVATSAFGAPVAVLNRNEPAFYCVPASTYEIMMDKLEDLELLAIAKKRLSEDSVSVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB H9L4R3

Antitoxin

Source ID Structure

References