294388

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-Phd
Location 816078..816656 Replicon chromosome
Accession NZ_LT992491
Organism Vibrio cholerae strain 4295STDY6534200

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag HUW69_RS17220 Protein ID WP_001180246.1
Coordinates 816339..816656 (+) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A366AI09
Locus tag HUW69_RS17215 Protein ID WP_000557291.1
Coordinates 816078..816320 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUW69_RS19155 811826..811922 - 97 Protein_685 DUF645 family protein -
HUW69_RS17190 812293..813264 - 972 WP_174566675.1 immunity 49 family protein -
HUW69_RS17195 813490..814038 - 549 WP_029628771.1 hypothetical protein -
HUW69_RS17200 814243..814422 - 180 WP_029628741.1 DUF645 family protein -
HUW69_RS17205 814730..815143 - 414 WP_000049413.1 VOC family protein -
HUW69_RS17210 815338..815814 - 477 WP_050485312.1 DUF2059 domain-containing protein -
HUW69_RS17215 816078..816320 + 243 WP_000557291.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
HUW69_RS17220 816339..816656 + 318 WP_001180246.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
HUW69_RS17225 816792..817259 - 468 WP_029628739.1 OsmC family protein -
HUW69_RS17230 817411..817956 - 546 WP_002033333.1 GNAT family N-acetyltransferase -
HUW69_RS17235 818095..818868 - 774 WP_000350773.1 NERD domain-containing protein -
HUW69_RS17240 819007..819390 - 384 WP_001081300.1 hypothetical protein -
HUW69_RS17245 819541..820281 - 741 WP_001923935.1 PhzF family phenazine biosynthesis protein -
HUW69_RS17250 820506..820688 - 183 WP_000923147.1 DUF645 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 806749..965214 158465
- inside Integron - - 806749..961958 155209


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-93)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-71)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12199.00 Da        Isoelectric Point: 9.5427

>T294388 WP_001180246.1 NZ_LT992491:816339-816656 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAETQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAD
FILIVAVLGQSQLPQKHLKHSRFVS

Download         Length: 318 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8931.22 Da        Isoelectric Point: 5.6630

>AT294388 WP_000557291.1 NZ_LT992491:816078-816320 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGAAFLNTL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A366AI09

References