Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-Phd |
| Location | 816078..816656 | Replicon | chromosome |
| Accession | NZ_LT992491 | ||
| Organism | Vibrio cholerae strain 4295STDY6534200 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | HUW69_RS17220 | Protein ID | WP_001180246.1 |
| Coordinates | 816339..816656 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A366AI09 |
| Locus tag | HUW69_RS17215 | Protein ID | WP_000557291.1 |
| Coordinates | 816078..816320 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HUW69_RS19155 | 811826..811922 | - | 97 | Protein_685 | DUF645 family protein | - |
| HUW69_RS17190 | 812293..813264 | - | 972 | WP_174566675.1 | immunity 49 family protein | - |
| HUW69_RS17195 | 813490..814038 | - | 549 | WP_029628771.1 | hypothetical protein | - |
| HUW69_RS17200 | 814243..814422 | - | 180 | WP_029628741.1 | DUF645 family protein | - |
| HUW69_RS17205 | 814730..815143 | - | 414 | WP_000049413.1 | VOC family protein | - |
| HUW69_RS17210 | 815338..815814 | - | 477 | WP_050485312.1 | DUF2059 domain-containing protein | - |
| HUW69_RS17215 | 816078..816320 | + | 243 | WP_000557291.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| HUW69_RS17220 | 816339..816656 | + | 318 | WP_001180246.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| HUW69_RS17225 | 816792..817259 | - | 468 | WP_029628739.1 | OsmC family protein | - |
| HUW69_RS17230 | 817411..817956 | - | 546 | WP_002033333.1 | GNAT family N-acetyltransferase | - |
| HUW69_RS17235 | 818095..818868 | - | 774 | WP_000350773.1 | NERD domain-containing protein | - |
| HUW69_RS17240 | 819007..819390 | - | 384 | WP_001081300.1 | hypothetical protein | - |
| HUW69_RS17245 | 819541..820281 | - | 741 | WP_001923935.1 | PhzF family phenazine biosynthesis protein | - |
| HUW69_RS17250 | 820506..820688 | - | 183 | WP_000923147.1 | DUF645 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 806749..965214 | 158465 | |
| - | inside | Integron | - | - | 806749..961958 | 155209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12199.00 Da Isoelectric Point: 9.5427
>T294388 WP_001180246.1 NZ_LT992491:816339-816656 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAETQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAD
FILIVAVLGQSQLPQKHLKHSRFVS
MQNKQYKLSQLAQEHLLKIKHYTIENFAETQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAD
FILIVAVLGQSQLPQKHLKHSRFVS
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|