Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RelB
Location 810275..810834 Replicon chromosome
Accession NZ_LT992491
Organism Vibrio cholerae strain 4295STDY6534200

Toxin (Protein)


Gene name relE Uniprot ID A0A0Q0N9E9
Locus tag HUW69_RS17175 Protein ID WP_000578475.1
Coordinates 810556..810834 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9L991
Locus tag HUW69_RS17170 Protein ID WP_000381183.1
Coordinates 810275..810559 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUW69_RS17145 805856..806083 - 228 WP_113605729.1 hypothetical protein -
HUW69_RS17150 806749..807735 + 987 WP_001170903.1 sulfate ABC transporter substrate-binding protein -
HUW69_RS17155 807956..808114 + 159 Protein_679 helix-turn-helix domain-containing protein -
HUW69_RS17160 808189..809369 + 1181 WP_113605730.1 IS3 family transposase -
HUW69_RS17165 809575..810072 - 498 WP_000259904.1 GNAT family N-acetyltransferase -
HUW69_RS17170 810275..810559 + 285 WP_000381183.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
HUW69_RS17175 810556..810834 + 279 WP_000578475.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
HUW69_RS17180 810974..811630 - 657 WP_174566674.1 hypothetical protein -
HUW69_RS19155 811826..811922 - 97 Protein_685 DUF645 family protein -
HUW69_RS17190 812293..813264 - 972 WP_174566675.1 immunity 49 family protein -
HUW69_RS17195 813490..814038 - 549 WP_029628771.1 hypothetical protein -
HUW69_RS17200 814243..814422 - 180 WP_029628741.1 DUF645 family protein -
HUW69_RS17205 814730..815143 - 414 WP_000049413.1 VOC family protein -
HUW69_RS17210 815338..815814 - 477 WP_050485312.1 DUF2059 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 806749..965214 158465
- inside Integron - - 806749..961958 155209


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-89)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-70)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10824.53 Da        Isoelectric Point: 4.6794

>T294387 WP_000578475.1 NZ_LT992491:810556-810834 [Vibrio cholerae]
MIFWEEASLNDREKIFEFLYDFNPAAAEKTDEVIEAKVENLLEQPLMGVQRDGIRGRLLIIPEISMIVSYWVDGSKIRIM
RVLHQKQKFPND

Download         Length: 279 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10901.25 Da        Isoelectric Point: 8.0775

>AT294387 WP_000381183.1 NZ_LT992491:810275-810559 [Vibrio cholerae]
MDTRIQFRVDEETKRLAQQMAESQGRTLSDACRELTEQLAEQQRKALSHDAWLTEQVNQAFEKFDSGKAVFIEHDIAKAR
MAERKAKIRNRGHA

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0N9E9

Antitoxin

Source ID Structure
AlphaFold DB A0A067BL33

References