Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 2416631..2417394 | Replicon | chromosome |
| Accession | NZ_LT992490 | ||
| Organism | Vibrio cholerae strain 4295STDY6534200 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A501Y1C9 |
| Locus tag | HUW69_RS10775 | Protein ID | WP_029627974.1 |
| Coordinates | 2416888..2417394 (+) | Length | 169 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A501XZ00 |
| Locus tag | HUW69_RS10770 | Protein ID | WP_032481064.1 |
| Coordinates | 2416631..2416897 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HUW69_RS10755 | 2413519..2414211 | - | 693 | WP_024008832.1 | DsbC family protein | - |
| HUW69_RS10760 | 2414553..2415491 | + | 939 | WP_029627976.1 | Abi family protein | - |
| HUW69_RS10765 | 2415917..2416453 | + | 537 | WP_029627975.1 | hypothetical protein | - |
| HUW69_RS10770 | 2416631..2416897 | + | 267 | WP_032481064.1 | DUF1778 domain-containing protein | Antitoxin |
| HUW69_RS10775 | 2416888..2417394 | + | 507 | WP_029627974.1 | GNAT family N-acetyltransferase | Toxin |
| HUW69_RS10780 | 2417435..2417821 | - | 387 | WP_029627973.1 | hypothetical protein | - |
| HUW69_RS10785 | 2417818..2418390 | - | 573 | WP_001944091.1 | type IV conjugative transfer system lipoprotein TraV | - |
| HUW69_RS10790 | 2418465..2419754 | - | 1290 | WP_029627971.1 | TraB/VirB10 family protein | - |
| HUW69_RS10795 | 2419757..2420653 | - | 897 | WP_032471966.1 | type-F conjugative transfer system secretin TraK | - |
| HUW69_RS10800 | 2420637..2421263 | - | 627 | WP_029627969.1 | pilus assembly protein | - |
| HUW69_RS10805 | 2421260..2421541 | - | 282 | WP_000433889.1 | type IV conjugative transfer system protein TraL | - |
| HUW69_RS10810 | 2421774..2422070 | + | 297 | WP_054104212.1 | HigA family addiction module antidote protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2315752..2450139 | 134387 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 169 a.a. Molecular weight: 18320.04 Da Isoelectric Point: 6.7043
>T294386 WP_029627974.1 NZ_LT992490:2416888-2417394 [Vibrio cholerae]
MGISAPTLLADEHQINAFQCGIEELDTWLRKQALKSQKRGTARVYVVNDTDAHQVVGYYAIAMGSVSREQAFSSLRRNSP
DPIPMVILARLGVDNAYQGQGIAAGLLKDCIIRSVQAMNAVGGAGILVHAIDDTAQTFYKKFGFKESTFDPLVLMARICD
IEKSLSID
MGISAPTLLADEHQINAFQCGIEELDTWLRKQALKSQKRGTARVYVVNDTDAHQVVGYYAIAMGSVSREQAFSSLRRNSP
DPIPMVILARLGVDNAYQGQGIAAGLLKDCIIRSVQAMNAVGGAGILVHAIDDTAQTFYKKFGFKESTFDPLVLMARICD
IEKSLSID
Download Length: 507 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A501Y1C9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A501XZ00 |