Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2389284..2389813 | Replicon | chromosome |
| Accession | NZ_LT992477 | ||
| Organism | Staphylococcus aureus isolate 22_LA_562 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | DXE38_RS12110 | Protein ID | WP_000621175.1 |
| Coordinates | 2389451..2389813 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | DXE38_RS12105 | Protein ID | WP_000948331.1 |
| Coordinates | 2389284..2389454 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE38_RS12075 | 2384320..2384880 | + | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
| DXE38_RS12080 | 2385089..2385568 | + | 480 | WP_001287081.1 | hypothetical protein | - |
| DXE38_RS12085 | 2385561..2387138 | + | 1578 | WP_001294650.1 | PH domain-containing protein | - |
| DXE38_RS12090 | 2387131..2387622 | + | 492 | WP_001286980.1 | PH domain-containing protein | - |
| DXE38_RS12095 | 2387626..2387985 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
| DXE38_RS12100 | 2388051..2389199 | + | 1149 | WP_001281139.1 | alanine racemase | - |
| DXE38_RS12105 | 2389284..2389454 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| DXE38_RS12110 | 2389451..2389813 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| DXE38_RS12120 | 2390163..2391164 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| DXE38_RS12125 | 2391283..2391609 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| DXE38_RS12130 | 2391611..2392090 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
| DXE38_RS12135 | 2392065..2392835 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T294340 WP_000621175.1 NZ_LT992477:2389451-2389813 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|