Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
| Location | 1359144..1359941 | Replicon | chromosome |
| Accession | NZ_LT992477 | ||
| Organism | Staphylococcus aureus isolate 22_LA_562 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | DXE38_RS07005 | Protein ID | WP_031910436.1 |
| Coordinates | 1359480..1359941 (+) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0C2LD36 |
| Locus tag | DXE38_RS07000 | Protein ID | WP_001260487.1 |
| Coordinates | 1359144..1359467 (+) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE38_RS06940 | 1355304..1355666 | - | 363 | WP_000985976.1 | hypothetical protein | - |
| DXE38_RS06945 | 1355681..1356004 | - | 324 | WP_000174994.1 | hypothetical protein | - |
| DXE38_RS06950 | 1356083..1356244 | - | 162 | WP_001285948.1 | DUF1270 domain-containing protein | - |
| DXE38_RS06955 | 1356257..1356520 | - | 264 | WP_016187436.1 | helix-turn-helix domain-containing protein | - |
| DXE38_RS06960 | 1356545..1356760 | - | 216 | WP_001097552.1 | hypothetical protein | - |
| DXE38_RS06965 | 1356816..1357025 | + | 210 | WP_000642492.1 | hypothetical protein | - |
| DXE38_RS06970 | 1357015..1357158 | - | 144 | WP_000939498.1 | hypothetical protein | - |
| DXE38_RS06975 | 1357225..1357605 | + | 381 | WP_000773059.1 | DUF2513 domain-containing protein | - |
| DXE38_RS06980 | 1357592..1357789 | - | 198 | WP_001148860.1 | hypothetical protein | - |
| DXE38_RS06985 | 1357859..1358071 | + | 213 | WP_000362644.1 | hypothetical protein | - |
| DXE38_RS14960 | 1358112..1358261 | - | 150 | WP_000771849.1 | hypothetical protein | - |
| DXE38_RS06990 | 1358276..1358719 | - | 444 | WP_000435362.1 | hypothetical protein | - |
| DXE38_RS06995 | 1358732..1358980 | - | 249 | WP_000272859.1 | helix-turn-helix domain-containing protein | - |
| DXE38_RS07000 | 1359144..1359467 | + | 324 | WP_001260487.1 | helix-turn-helix domain-containing protein | Antitoxin |
| DXE38_RS07005 | 1359480..1359941 | + | 462 | WP_031910436.1 | toxin | Toxin |
| DXE38_RS07010 | 1359959..1360393 | + | 435 | WP_031910435.1 | hypothetical protein | - |
| DXE38_RS07015 | 1360422..1360817 | + | 396 | WP_000449655.1 | hypothetical protein | - |
| DXE38_RS07020 | 1360905..1361051 | + | 147 | WP_078067907.1 | hypothetical protein | - |
| DXE38_RS07025 | 1361048..1361662 | - | 615 | WP_000191459.1 | hypothetical protein | - |
| DXE38_RS07030 | 1361788..1362993 | + | 1206 | WP_031794994.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1317604..1362993 | 45389 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 17963.23 Da Isoelectric Point: 4.9129
>T294334 WP_031910436.1 NZ_LT992477:1359480-1359941 [Staphylococcus aureus]
MGLYEETLIQHDYIETREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFTSAVPLHEIVEAHNYGVRNLYELSEYLQLSESYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIETREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFTSAVPLHEIVEAHNYGVRNLYELSEYLQLSESYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|