Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 1359144..1359941 Replicon chromosome
Accession NZ_LT992477
Organism Staphylococcus aureus isolate 22_LA_562

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag DXE38_RS07005 Protein ID WP_031910436.1
Coordinates 1359480..1359941 (+) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0C2LD36
Locus tag DXE38_RS07000 Protein ID WP_001260487.1
Coordinates 1359144..1359467 (+) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE38_RS06940 1355304..1355666 - 363 WP_000985976.1 hypothetical protein -
DXE38_RS06945 1355681..1356004 - 324 WP_000174994.1 hypothetical protein -
DXE38_RS06950 1356083..1356244 - 162 WP_001285948.1 DUF1270 domain-containing protein -
DXE38_RS06955 1356257..1356520 - 264 WP_016187436.1 helix-turn-helix domain-containing protein -
DXE38_RS06960 1356545..1356760 - 216 WP_001097552.1 hypothetical protein -
DXE38_RS06965 1356816..1357025 + 210 WP_000642492.1 hypothetical protein -
DXE38_RS06970 1357015..1357158 - 144 WP_000939498.1 hypothetical protein -
DXE38_RS06975 1357225..1357605 + 381 WP_000773059.1 DUF2513 domain-containing protein -
DXE38_RS06980 1357592..1357789 - 198 WP_001148860.1 hypothetical protein -
DXE38_RS06985 1357859..1358071 + 213 WP_000362644.1 hypothetical protein -
DXE38_RS14960 1358112..1358261 - 150 WP_000771849.1 hypothetical protein -
DXE38_RS06990 1358276..1358719 - 444 WP_000435362.1 hypothetical protein -
DXE38_RS06995 1358732..1358980 - 249 WP_000272859.1 helix-turn-helix domain-containing protein -
DXE38_RS07000 1359144..1359467 + 324 WP_001260487.1 helix-turn-helix domain-containing protein Antitoxin
DXE38_RS07005 1359480..1359941 + 462 WP_031910436.1 toxin Toxin
DXE38_RS07010 1359959..1360393 + 435 WP_031910435.1 hypothetical protein -
DXE38_RS07015 1360422..1360817 + 396 WP_000449655.1 hypothetical protein -
DXE38_RS07020 1360905..1361051 + 147 WP_078067907.1 hypothetical protein -
DXE38_RS07025 1361048..1361662 - 615 WP_000191459.1 hypothetical protein -
DXE38_RS07030 1361788..1362993 + 1206 WP_031794994.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1317604..1362993 45389


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 17963.23 Da        Isoelectric Point: 4.9129

>T294334 WP_031910436.1 NZ_LT992477:1359480-1359941 [Staphylococcus aureus]
MGLYEETLIQHDYIETREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFTSAVPLHEIVEAHNYGVRNLYELSEYLQLSESYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12431.09 Da        Isoelectric Point: 9.3811

>AT294334 WP_001260487.1 NZ_LT992477:1359144-1359467 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNVNLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANALKVTPEYLLLKNRQTENEVQHRA
AHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0C2LD36

References