Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 799696..800172 Replicon chromosome
Accession NZ_LT992477
Organism Staphylococcus aureus isolate 22_LA_562

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DXE38_RS04005 Protein ID WP_000052076.1
Coordinates 799984..800172 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DXE38_RS04000 Protein ID WP_001059690.1
Coordinates 799696..799956 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE38_RS03965 795094..795810 - 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -
DXE38_RS03970 795958..796380 + 423 WP_000974452.1 organic hydroperoxide resistance protein -
DXE38_RS03975 796779..797273 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
DXE38_RS03980 797422..798039 + 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
DXE38_RS03985 798112..798693 - 582 WP_001140696.1 phosphoglycerate mutase family protein -
DXE38_RS03990 798918..799154 + 237 WP_000368687.1 hypothetical protein -
DXE38_RS03995 799151..799354 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DXE38_RS04000 799696..799956 + 261 WP_001059690.1 hypothetical protein Antitoxin
DXE38_RS04005 799984..800172 + 189 WP_000052076.1 hypothetical protein Toxin
DXE38_RS04010 800360..800929 + 570 WP_106095052.1 hypothetical protein -
DXE38_RS04015 801017..801301 + 285 WP_001004403.1 hypothetical protein -
DXE38_RS04020 801362..801580 + 219 WP_000005881.1 hypothetical protein -
DXE38_RS04025 802077..802277 - 201 WP_001059082.1 cold-shock protein -
DXE38_RS04030 802634..803320 - 687 WP_001574556.1 thermonuclease family protein -
DXE38_RS04035 803661..804143 - 483 WP_000824489.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T294333 WP_000052076.1 NZ_LT992477:799984-800172 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT294333 WP_001059690.1 NZ_LT992477:799696-799956 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References