Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 2736742..2737530 Replicon chromosome
Accession NZ_LT992476
Organism Staphylococcus aureus isolate 21_LA_436

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag DXE57_RS14320 Protein ID WP_000525004.1
Coordinates 2737069..2737530 (+) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag DXE57_RS14315 Protein ID WP_000333630.1
Coordinates 2736742..2737056 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE57_RS14255 2731883..2733049 - 1167 WP_000762534.1 DUF2800 domain-containing protein -
DXE57_RS14260 2733046..2733408 - 363 WP_000985986.1 hypothetical protein -
DXE57_RS14265 2733423..2733746 - 324 WP_000174994.1 hypothetical protein -
DXE57_RS14270 2733825..2733986 - 162 WP_031882238.1 DUF1270 family protein -
DXE57_RS14275 2733999..2734262 - 264 WP_001124190.1 helix-turn-helix domain-containing protein -
DXE57_RS14280 2734287..2734502 - 216 WP_001036302.1 hypothetical protein -
DXE57_RS14285 2734557..2734922 + 366 WP_001128433.1 hypothetical protein -
DXE57_RS14290 2734891..2735136 - 246 WP_001025401.1 DUF2829 domain-containing protein -
DXE57_RS14295 2735192..2735401 + 210 WP_000642492.1 hypothetical protein -
DXE57_RS14300 2735391..2735534 - 144 WP_000939498.1 hypothetical protein -
DXE57_RS14305 2735563..2736339 - 777 WP_001148544.1 Rha family transcriptional regulator -
DXE57_RS14310 2736353..2736589 - 237 WP_001121027.1 helix-turn-helix domain-containing protein -
DXE57_RS14315 2736742..2737056 + 315 WP_000333630.1 helix-turn-helix domain-containing protein Antitoxin
DXE57_RS14320 2737069..2737530 + 462 WP_000525004.1 hypothetical protein Toxin
DXE57_RS14325 2737548..2738132 + 585 WP_079219805.1 hypothetical protein -
DXE57_RS14330 2738361..2738507 + 147 WP_001013104.1 hypothetical protein -
DXE57_RS14335 2738504..2739118 - 615 WP_000191466.1 hypothetical protein -
DXE57_RS14340 2739244..2740449 + 1206 WP_000264745.1 site-specific integrase -
DXE57_RS14345 2740543..2742477 - 1935 Protein_2660 YSIRK domain-containing triacylglycerol lipase Lip2/Geh -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2695350..2740449 45099


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T294329 WP_000525004.1 NZ_LT992476:2737069-2737530 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT294329 WP_000333630.1 NZ_LT992476:2736742-2737056 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References