Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
Location | 2736742..2737530 | Replicon | chromosome |
Accession | NZ_LT992476 | ||
Organism | Staphylococcus aureus isolate 21_LA_436 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A2I7Y5B3 |
Locus tag | DXE57_RS14320 | Protein ID | WP_000525004.1 |
Coordinates | 2737069..2737530 (+) | Length | 154 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A0E7YIA0 |
Locus tag | DXE57_RS14315 | Protein ID | WP_000333630.1 |
Coordinates | 2736742..2737056 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE57_RS14255 | 2731883..2733049 | - | 1167 | WP_000762534.1 | DUF2800 domain-containing protein | - |
DXE57_RS14260 | 2733046..2733408 | - | 363 | WP_000985986.1 | hypothetical protein | - |
DXE57_RS14265 | 2733423..2733746 | - | 324 | WP_000174994.1 | hypothetical protein | - |
DXE57_RS14270 | 2733825..2733986 | - | 162 | WP_031882238.1 | DUF1270 family protein | - |
DXE57_RS14275 | 2733999..2734262 | - | 264 | WP_001124190.1 | helix-turn-helix domain-containing protein | - |
DXE57_RS14280 | 2734287..2734502 | - | 216 | WP_001036302.1 | hypothetical protein | - |
DXE57_RS14285 | 2734557..2734922 | + | 366 | WP_001128433.1 | hypothetical protein | - |
DXE57_RS14290 | 2734891..2735136 | - | 246 | WP_001025401.1 | DUF2829 domain-containing protein | - |
DXE57_RS14295 | 2735192..2735401 | + | 210 | WP_000642492.1 | hypothetical protein | - |
DXE57_RS14300 | 2735391..2735534 | - | 144 | WP_000939498.1 | hypothetical protein | - |
DXE57_RS14305 | 2735563..2736339 | - | 777 | WP_001148544.1 | Rha family transcriptional regulator | - |
DXE57_RS14310 | 2736353..2736589 | - | 237 | WP_001121027.1 | helix-turn-helix domain-containing protein | - |
DXE57_RS14315 | 2736742..2737056 | + | 315 | WP_000333630.1 | helix-turn-helix domain-containing protein | Antitoxin |
DXE57_RS14320 | 2737069..2737530 | + | 462 | WP_000525004.1 | hypothetical protein | Toxin |
DXE57_RS14325 | 2737548..2738132 | + | 585 | WP_079219805.1 | hypothetical protein | - |
DXE57_RS14330 | 2738361..2738507 | + | 147 | WP_001013104.1 | hypothetical protein | - |
DXE57_RS14335 | 2738504..2739118 | - | 615 | WP_000191466.1 | hypothetical protein | - |
DXE57_RS14340 | 2739244..2740449 | + | 1206 | WP_000264745.1 | site-specific integrase | - |
DXE57_RS14345 | 2740543..2742477 | - | 1935 | Protein_2660 | YSIRK domain-containing triacylglycerol lipase Lip2/Geh | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2695350..2740449 | 45099 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18074.46 Da Isoelectric Point: 4.6915
>T294329 WP_000525004.1 NZ_LT992476:2737069-2737530 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I7Y5B3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E7YIA0 |