Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
| Location | 2099289..2100086 | Replicon | chromosome |
| Accession | NZ_LT992475 | ||
| Organism | Staphylococcus aureus isolate 20_LA_415 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | DXE41_RS11235 | Protein ID | WP_031838007.1 |
| Coordinates | 2099625..2100086 (+) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | DXE41_RS11230 | Protein ID | WP_001260485.1 |
| Coordinates | 2099289..2099612 (+) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE41_RS11180 | 2095025..2095582 | - | 558 | WP_000645042.1 | DUF2815 family protein | - |
| DXE41_RS11185 | 2095608..2096774 | - | 1167 | WP_000762547.1 | DUF2800 domain-containing protein | - |
| DXE41_RS11190 | 2096771..2097133 | - | 363 | WP_031775157.1 | hypothetical protein | - |
| DXE41_RS11195 | 2097148..2097471 | - | 324 | WP_000174994.1 | hypothetical protein | - |
| DXE41_RS11200 | 2097550..2097711 | - | 162 | WP_001285963.1 | DUF1270 family protein | - |
| DXE41_RS11205 | 2097724..2097987 | - | 264 | WP_001124190.1 | helix-turn-helix domain-containing protein | - |
| DXE41_RS11210 | 2098012..2098227 | - | 216 | WP_001036302.1 | hypothetical protein | - |
| DXE41_RS11215 | 2098282..2098647 | + | 366 | WP_001128433.1 | hypothetical protein | - |
| DXE41_RS11220 | 2098616..2098861 | - | 246 | WP_001025401.1 | DUF2829 domain-containing protein | - |
| DXE41_RS11225 | 2098877..2099125 | - | 249 | WP_000272860.1 | helix-turn-helix domain-containing protein | - |
| DXE41_RS11230 | 2099289..2099612 | + | 324 | WP_001260485.1 | helix-turn-helix domain-containing protein | Antitoxin |
| DXE41_RS11235 | 2099625..2100086 | + | 462 | WP_031838007.1 | toxin | Toxin |
| DXE41_RS11240 | 2100104..2100538 | + | 435 | WP_000755718.1 | hypothetical protein | - |
| DXE41_RS11245 | 2100567..2100962 | + | 396 | WP_000449655.1 | hypothetical protein | - |
| DXE41_RS11250 | 2101052..2101198 | + | 147 | WP_074370993.1 | hypothetical protein | - |
| DXE41_RS11255 | 2101195..2101809 | - | 615 | WP_000191466.1 | hypothetical protein | - |
| DXE41_RS11260 | 2101935..2103140 | + | 1206 | WP_000264745.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2059099..2103140 | 44041 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18006.39 Da Isoelectric Point: 4.9167
>T294311 WP_031838007.1 NZ_LT992475:2099625-2100086 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAHNYGVRNLYELSEYLQLSESYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAHNYGVRNLYELSEYLQLSESYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|