Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1498869..1499345 Replicon chromosome
Accession NZ_LT992474
Organism Staphylococcus aureus isolate 19_LA_388

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DXE66_RS07620 Protein ID WP_000052076.1
Coordinates 1498869..1499057 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DXE66_RS07625 Protein ID WP_001059690.1
Coordinates 1499085..1499345 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE66_RS07590 1494898..1495380 + 483 WP_000824489.1 hypothetical protein -
DXE66_RS07595 1495721..1496407 + 687 WP_001574556.1 thermonuclease family protein -
DXE66_RS07600 1496764..1496964 + 201 WP_001059082.1 cold-shock protein -
DXE66_RS07605 1497461..1497679 - 219 WP_000005881.1 hypothetical protein -
DXE66_RS07610 1497740..1498024 - 285 WP_001004403.1 hypothetical protein -
DXE66_RS07615 1498112..1498681 - 570 WP_001106655.1 hypothetical protein -
DXE66_RS07620 1498869..1499057 - 189 WP_000052076.1 hypothetical protein Toxin
DXE66_RS07625 1499085..1499345 - 261 WP_001059690.1 hypothetical protein Antitoxin
DXE66_RS07630 1499687..1499890 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DXE66_RS07635 1499887..1500123 - 237 WP_000368687.1 hypothetical protein -
DXE66_RS07640 1500348..1500929 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
DXE66_RS07645 1501002..1501619 - 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
DXE66_RS07650 1501768..1502262 - 495 WP_000569881.1 GNAT family N-acetyltransferase -
DXE66_RS07655 1502661..1503083 - 423 WP_000974452.1 organic hydroperoxide resistance protein -
DXE66_RS07660 1503231..1503947 + 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T294284 WP_000052076.1 NZ_LT992474:c1499057-1498869 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT294284 WP_001059690.1 NZ_LT992474:c1499345-1499085 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References