Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 958872..959660 Replicon chromosome
Accession NZ_LT992474
Organism Staphylococcus aureus isolate 19_LA_388

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag DXE66_RS04740 Protein ID WP_000525004.1
Coordinates 958872..959333 (-) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag DXE66_RS04745 Protein ID WP_000333630.1
Coordinates 959346..959660 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE66_RS04715 953940..955874 + 1935 Protein_889 YSIRK domain-containing triacylglycerol lipase Lip2/Geh -
DXE66_RS04720 955968..957173 - 1206 WP_000264185.1 site-specific integrase -
DXE66_RS04725 957283..957897 + 615 WP_000191461.1 hypothetical protein -
DXE66_RS04730 957894..958040 - 147 WP_001013104.1 hypothetical protein -
DXE66_RS04735 958270..958854 - 585 WP_000825948.1 hypothetical protein -
DXE66_RS04740 958872..959333 - 462 WP_000525004.1 hypothetical protein Toxin
DXE66_RS04745 959346..959660 - 315 WP_000333630.1 helix-turn-helix domain-containing protein Antitoxin
DXE66_RS04750 959812..960048 + 237 WP_001121027.1 helix-turn-helix domain-containing protein -
DXE66_RS04755 960062..960838 + 777 WP_001148544.1 Rha family transcriptional regulator -
DXE66_RS04760 960867..961010 + 144 WP_000939498.1 hypothetical protein -
DXE66_RS04765 961000..961209 - 210 WP_000642492.1 hypothetical protein -
DXE66_RS04770 961265..961510 + 246 WP_001025401.1 DUF2829 domain-containing protein -
DXE66_RS04775 961479..961844 - 366 WP_001128433.1 hypothetical protein -
DXE66_RS04780 961899..962114 + 216 WP_001036302.1 hypothetical protein -
DXE66_RS04785 962139..962402 + 264 WP_001124190.1 helix-turn-helix domain-containing protein -
DXE66_RS04790 962415..962576 + 162 WP_001285963.1 DUF1270 family protein -
DXE66_RS04795 962655..962978 + 324 WP_000174994.1 hypothetical protein -
DXE66_RS04800 962993..963355 + 363 WP_000985976.1 hypothetical protein -
DXE66_RS04805 963352..964518 + 1167 WP_000762545.1 DUF2800 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 955968..1001033 45065


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T294281 WP_000525004.1 NZ_LT992474:c959333-958872 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT294281 WP_000333630.1 NZ_LT992474:c959660-959346 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References