Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 2804648..2805424 | Replicon | chromosome |
Accession | NZ_LT992473 | ||
Organism | Staphylococcus aureus isolate 14_5418 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | DXE48_RS14420 | Protein ID | WP_000031108.1 |
Coordinates | 2805272..2805424 (+) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | DXE48_RS14415 | Protein ID | WP_001251224.1 |
Coordinates | 2804648..2805247 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE48_RS14395 | 2800564..2802021 | + | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
DXE48_RS14400 | 2802014..2802736 | + | 723 | WP_031774878.1 | amino acid ABC transporter ATP-binding protein | - |
DXE48_RS14405 | 2802887..2804014 | + | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
DXE48_RS14410 | 2804019..2804489 | + | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
DXE48_RS14415 | 2804648..2805247 | + | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
DXE48_RS14420 | 2805272..2805424 | + | 153 | WP_000031108.1 | hypothetical protein | Toxin |
DXE48_RS14430 | 2805967..2806362 | + | 396 | WP_000901018.1 | hypothetical protein | - |
DXE48_RS14435 | 2806558..2807943 | + | 1386 | WP_000116238.1 | class II fumarate hydratase | - |
DXE48_RS14440 | 2808398..2809219 | - | 822 | WP_000669380.1 | RluA family pseudouridine synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T294279 WP_000031108.1 NZ_LT992473:2805272-2805424 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT294279 WP_001251224.1 NZ_LT992473:2804648-2805247 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|