Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2600963..2601492 | Replicon | chromosome |
| Accession | NZ_LT992473 | ||
| Organism | Staphylococcus aureus isolate 14_5418 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | DXE48_RS13115 | Protein ID | WP_000621175.1 |
| Coordinates | 2601130..2601492 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | DXE48_RS13110 | Protein ID | WP_000948331.1 |
| Coordinates | 2600963..2601133 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE48_RS13080 | 2595999..2596559 | + | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
| DXE48_RS13085 | 2596768..2597247 | + | 480 | WP_001287081.1 | hypothetical protein | - |
| DXE48_RS13090 | 2597240..2598817 | + | 1578 | WP_001294650.1 | PH domain-containing protein | - |
| DXE48_RS13095 | 2598810..2599301 | + | 492 | WP_001286980.1 | PH domain-containing protein | - |
| DXE48_RS13100 | 2599305..2599664 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
| DXE48_RS13105 | 2599730..2600878 | + | 1149 | WP_001281139.1 | alanine racemase | - |
| DXE48_RS13110 | 2600963..2601133 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| DXE48_RS13115 | 2601130..2601492 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| DXE48_RS13125 | 2601842..2602843 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| DXE48_RS13130 | 2602962..2603288 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| DXE48_RS13135 | 2603290..2603769 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
| DXE48_RS13140 | 2603744..2604514 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T294275 WP_000621175.1 NZ_LT992473:2601130-2601492 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|