Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1850221..1850697 Replicon chromosome
Accession NZ_LT992472
Organism Staphylococcus aureus isolate 10_5235

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DXE26_RS09630 Protein ID WP_000052076.1
Coordinates 1850221..1850409 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DXE26_RS09635 Protein ID WP_001059690.1
Coordinates 1850437..1850697 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE26_RS09600 1846250..1846732 + 483 WP_000824489.1 hypothetical protein -
DXE26_RS09605 1847073..1847759 + 687 WP_001574556.1 thermonuclease family protein -
DXE26_RS09610 1848116..1848316 + 201 WP_001059082.1 cold-shock protein -
DXE26_RS09615 1848813..1849031 - 219 WP_000005881.1 hypothetical protein -
DXE26_RS09620 1849092..1849376 - 285 WP_001004403.1 hypothetical protein -
DXE26_RS09625 1849464..1850033 - 570 WP_001106655.1 hypothetical protein -
DXE26_RS09630 1850221..1850409 - 189 WP_000052076.1 hypothetical protein Toxin
DXE26_RS09635 1850437..1850697 - 261 WP_001059690.1 hypothetical protein Antitoxin
DXE26_RS09640 1851039..1851242 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DXE26_RS09645 1851239..1851475 - 237 WP_000368687.1 hypothetical protein -
DXE26_RS09650 1851700..1852281 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
DXE26_RS09655 1852354..1852971 - 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
DXE26_RS09660 1853120..1853614 - 495 WP_000569881.1 GNAT family N-acetyltransferase -
DXE26_RS09665 1854013..1854435 - 423 WP_000974452.1 organic hydroperoxide resistance protein -
DXE26_RS09670 1854583..1855299 + 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T294262 WP_000052076.1 NZ_LT992472:c1850409-1850221 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT294262 WP_001059690.1 NZ_LT992472:c1850697-1850437 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References