Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 252262..252791 | Replicon | chromosome |
| Accession | NZ_LT992472 | ||
| Organism | Staphylococcus aureus isolate 10_5235 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | DXE26_RS01455 | Protein ID | WP_000621175.1 |
| Coordinates | 252262..252624 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | DXE26_RS01460 | Protein ID | WP_000948331.1 |
| Coordinates | 252621..252791 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE26_RS01430 | 249240..250010 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
| DXE26_RS01435 | 249985..250464 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
| DXE26_RS01440 | 250466..250792 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| DXE26_RS01445 | 250911..251912 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| DXE26_RS01455 | 252262..252624 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| DXE26_RS01460 | 252621..252791 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| DXE26_RS01465 | 252876..254024 | - | 1149 | WP_001281139.1 | alanine racemase | - |
| DXE26_RS01470 | 254090..254449 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
| DXE26_RS01475 | 254453..254944 | - | 492 | WP_001286980.1 | PH domain-containing protein | - |
| DXE26_RS01480 | 254937..256514 | - | 1578 | WP_001294650.1 | PH domain-containing protein | - |
| DXE26_RS01485 | 256507..256986 | - | 480 | WP_001287081.1 | hypothetical protein | - |
| DXE26_RS01490 | 257195..257755 | - | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T294254 WP_000621175.1 NZ_LT992472:c252624-252262 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|