Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2252263..2252792 | Replicon | chromosome |
| Accession | NZ_LT992471 | ||
| Organism | Staphylococcus aureus isolate 17_LA_343 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | DXE46_RS11720 | Protein ID | WP_000621175.1 |
| Coordinates | 2252263..2252625 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | DXE46_RS11725 | Protein ID | WP_000948331.1 |
| Coordinates | 2252622..2252792 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE46_RS11695 | 2249241..2250011 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
| DXE46_RS11700 | 2249986..2250465 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
| DXE46_RS11705 | 2250467..2250793 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| DXE46_RS11710 | 2250912..2251913 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| DXE46_RS11720 | 2252263..2252625 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| DXE46_RS11725 | 2252622..2252792 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| DXE46_RS11730 | 2252877..2254025 | - | 1149 | WP_001281139.1 | alanine racemase | - |
| DXE46_RS11735 | 2254091..2254450 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
| DXE46_RS11740 | 2254454..2254945 | - | 492 | WP_001286980.1 | PH domain-containing protein | - |
| DXE46_RS11745 | 2254938..2256515 | - | 1578 | WP_001294650.1 | PH domain-containing protein | - |
| DXE46_RS11750 | 2256508..2256987 | - | 480 | WP_001287081.1 | hypothetical protein | - |
| DXE46_RS11755 | 2257196..2257756 | - | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T294246 WP_000621175.1 NZ_LT992471:c2252625-2252263 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|