Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 2044000..2044776 | Replicon | chromosome |
Accession | NZ_LT992471 | ||
Organism | Staphylococcus aureus isolate 17_LA_343 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | DXE46_RS10420 | Protein ID | WP_000031108.1 |
Coordinates | 2044000..2044152 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | DXE46_RS10425 | Protein ID | WP_001251224.1 |
Coordinates | 2044177..2044776 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE46_RS10400 | 2040205..2041026 | + | 822 | WP_000669380.1 | RluA family pseudouridine synthase | - |
DXE46_RS10405 | 2041481..2042866 | - | 1386 | WP_000116238.1 | class II fumarate hydratase | - |
DXE46_RS10410 | 2043062..2043457 | - | 396 | WP_000901018.1 | hypothetical protein | - |
DXE46_RS10420 | 2044000..2044152 | - | 153 | WP_000031108.1 | hypothetical protein | Toxin |
DXE46_RS10425 | 2044177..2044776 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
DXE46_RS10430 | 2044935..2045405 | - | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
DXE46_RS10435 | 2045410..2046537 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
DXE46_RS10440 | 2046688..2047410 | - | 723 | WP_031774878.1 | amino acid ABC transporter ATP-binding protein | - |
DXE46_RS10445 | 2047403..2048860 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T294242 WP_000031108.1 NZ_LT992471:c2044152-2044000 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT294242 WP_001251224.1 NZ_LT992471:c2044776-2044177 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|