Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 995549..996025 Replicon chromosome
Accession NZ_LT992471
Organism Staphylococcus aureus isolate 17_LA_343

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DXE46_RS05160 Protein ID WP_000052076.1
Coordinates 995549..995737 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DXE46_RS05165 Protein ID WP_001059690.1
Coordinates 995765..996025 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE46_RS05130 991578..992060 + 483 WP_000824489.1 hypothetical protein -
DXE46_RS05135 992401..993087 + 687 WP_001574556.1 thermonuclease family protein -
DXE46_RS05140 993444..993644 + 201 WP_001059082.1 cold-shock protein -
DXE46_RS05145 994141..994359 - 219 WP_000005881.1 hypothetical protein -
DXE46_RS05150 994420..994704 - 285 WP_001004403.1 hypothetical protein -
DXE46_RS05155 994792..995361 - 570 WP_106095052.1 hypothetical protein -
DXE46_RS05160 995549..995737 - 189 WP_000052076.1 hypothetical protein Toxin
DXE46_RS05165 995765..996025 - 261 WP_001059690.1 hypothetical protein Antitoxin
DXE46_RS05170 996367..996570 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DXE46_RS05175 996567..996803 - 237 WP_000368687.1 hypothetical protein -
DXE46_RS05180 997028..997609 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
DXE46_RS05185 997682..998299 - 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
DXE46_RS05190 998448..998942 - 495 WP_000569881.1 GNAT family N-acetyltransferase -
DXE46_RS05195 999341..999763 - 423 WP_000974452.1 organic hydroperoxide resistance protein -
DXE46_RS05200 999911..1000627 + 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - vWbp 937688..997609 59921


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T294241 WP_000052076.1 NZ_LT992471:c995737-995549 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT294241 WP_001059690.1 NZ_LT992471:c996025-995765 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References