294237

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 394505..395302 Replicon chromosome
Accession NZ_LT992471
Organism Staphylococcus aureus isolate 17_LA_343

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag DXE46_RS01830 Protein ID WP_031910436.1
Coordinates 394505..394966 (-) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0C2LD36
Locus tag DXE46_RS01835 Protein ID WP_001260487.1
Coordinates 394979..395302 (-) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE46_RS01805 391453..392658 - 1206 WP_031794994.1 site-specific integrase -
DXE46_RS01810 392784..393398 + 615 WP_000191459.1 hypothetical protein -
DXE46_RS01815 393395..393541 - 147 WP_078067907.1 hypothetical protein -
DXE46_RS01820 393629..394024 - 396 WP_000449655.1 hypothetical protein -
DXE46_RS01825 394053..394487 - 435 WP_031910435.1 hypothetical protein -
DXE46_RS01830 394505..394966 - 462 WP_031910436.1 toxin Toxin
DXE46_RS01835 394979..395302 - 324 WP_001260487.1 helix-turn-helix domain-containing protein Antitoxin
DXE46_RS01840 395466..395714 + 249 WP_000272859.1 helix-turn-helix domain-containing protein -
DXE46_RS01845 395727..396170 + 444 WP_000435362.1 hypothetical protein -
DXE46_RS15245 396185..396334 + 150 WP_000771849.1 hypothetical protein -
DXE46_RS01850 396375..396587 - 213 WP_000362644.1 hypothetical protein -
DXE46_RS01855 396657..396854 + 198 WP_001148860.1 hypothetical protein -
DXE46_RS01860 396841..397221 - 381 WP_000773059.1 DUF2513 domain-containing protein -
DXE46_RS01865 397288..397431 + 144 WP_000939498.1 hypothetical protein -
DXE46_RS01870 397421..397630 - 210 WP_000642492.1 hypothetical protein -
DXE46_RS01875 397686..397931 + 246 WP_001025401.1 DUF2829 domain-containing protein -
DXE46_RS01880 397900..398265 - 366 WP_016170627.1 hypothetical protein -
DXE46_RS01885 398320..398535 + 216 WP_001097552.1 hypothetical protein -
DXE46_RS01890 398560..398823 + 264 WP_016187436.1 helix-turn-helix domain-containing protein -
DXE46_RS01895 398836..398997 + 162 WP_001285948.1 DUF1270 domain-containing protein -
DXE46_RS01900 399076..399399 + 324 WP_000174994.1 hypothetical protein -
DXE46_RS01905 399414..399776 + 363 WP_000985976.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 391453..438212 46759


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 17963.23 Da        Isoelectric Point: 4.9129

>T294237 WP_031910436.1 NZ_LT992471:c394966-394505 [Staphylococcus aureus]
MGLYEETLIQHDYIETREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFTSAVPLHEIVEAHNYGVRNLYELSEYLQLSESYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12431.09 Da        Isoelectric Point: 9.3811

>AT294237 WP_001260487.1 NZ_LT992471:c395302-394979 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNVNLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANALKVTPEYLLLKNRQTENEVQHRA
AHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0C2LD36

References