Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 2708369..2709145 | Replicon | chromosome |
Accession | NZ_LT992470 | ||
Organism | Staphylococcus aureus isolate 13_LA_301 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | DXE64_RS14075 | Protein ID | WP_000031108.1 |
Coordinates | 2708993..2709145 (+) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | DXE64_RS14070 | Protein ID | WP_001251224.1 |
Coordinates | 2708369..2708968 (+) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE64_RS14050 | 2704285..2705742 | + | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
DXE64_RS14055 | 2705735..2706457 | + | 723 | WP_031774878.1 | amino acid ABC transporter ATP-binding protein | - |
DXE64_RS14060 | 2706608..2707735 | + | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
DXE64_RS14065 | 2707740..2708210 | + | 471 | WP_000181394.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
DXE64_RS14070 | 2708369..2708968 | + | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
DXE64_RS14075 | 2708993..2709145 | + | 153 | WP_000031108.1 | hypothetical protein | Toxin |
DXE64_RS14085 | 2709688..2710083 | + | 396 | WP_000901018.1 | hypothetical protein | - |
DXE64_RS14090 | 2710279..2711664 | + | 1386 | WP_000116238.1 | class II fumarate hydratase | - |
DXE64_RS14095 | 2712119..2712940 | - | 822 | WP_000669380.1 | RluA family pseudouridine synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T294236 WP_000031108.1 NZ_LT992470:2708993-2709145 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT294236 WP_001251224.1 NZ_LT992470:2708369-2708968 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|