Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1430072..1430548 Replicon chromosome
Accession NZ_LT992469
Organism Staphylococcus aureus isolate 15_LA_305

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DXE36_RS07605 Protein ID WP_000052076.1
Coordinates 1430360..1430548 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DXE36_RS07600 Protein ID WP_001059690.1
Coordinates 1430072..1430332 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE36_RS07565 1425470..1426186 - 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -
DXE36_RS07570 1426334..1426756 + 423 WP_000974452.1 organic hydroperoxide resistance protein -
DXE36_RS07575 1427155..1427649 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
DXE36_RS07580 1427798..1428415 + 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
DXE36_RS07585 1428488..1429069 - 582 WP_001140696.1 phosphoglycerate mutase family protein -
DXE36_RS07590 1429294..1429530 + 237 WP_000368687.1 hypothetical protein -
DXE36_RS07595 1429527..1429730 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DXE36_RS07600 1430072..1430332 + 261 WP_001059690.1 hypothetical protein Antitoxin
DXE36_RS07605 1430360..1430548 + 189 WP_000052076.1 hypothetical protein Toxin
DXE36_RS07610 1430736..1431305 + 570 WP_001106655.1 hypothetical protein -
DXE36_RS07615 1431393..1431677 + 285 WP_001004403.1 hypothetical protein -
DXE36_RS07620 1431738..1431956 + 219 WP_000005881.1 hypothetical protein -
DXE36_RS07625 1432453..1432653 - 201 WP_001059082.1 cold-shock protein -
DXE36_RS07630 1433010..1433696 - 687 WP_001574556.1 thermonuclease family protein -
DXE36_RS07635 1434037..1434519 - 483 WP_000824489.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T294219 WP_000052076.1 NZ_LT992469:1430360-1430548 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT294219 WP_001059690.1 NZ_LT992469:1430072-1430332 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References