Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
Location | 711747..712535 | Replicon | chromosome |
Accession | NZ_LT992469 | ||
Organism | Staphylococcus aureus isolate 15_LA_305 |
Toxin (Protein)
Gene name | - | Uniprot ID | A0A2I7Y5B3 |
Locus tag | DXE36_RS03975 | Protein ID | WP_000525004.1 |
Coordinates | 711747..712208 (-) | Length | 154 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A0E7YIA0 |
Locus tag | DXE36_RS03980 | Protein ID | WP_000333630.1 |
Coordinates | 712221..712535 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE36_RS03950 | 706772..708799 | + | 2028 | WP_014532489.1 | hypothetical protein | - |
DXE36_RS03955 | 708842..710047 | - | 1206 | WP_031871821.1 | site-specific integrase | - |
DXE36_RS03960 | 710158..710772 | + | 615 | WP_000191466.1 | hypothetical protein | - |
DXE36_RS03965 | 710769..710915 | - | 147 | WP_001794606.1 | hypothetical protein | - |
DXE36_RS03970 | 711145..711729 | - | 585 | WP_000825948.1 | hypothetical protein | - |
DXE36_RS03975 | 711747..712208 | - | 462 | WP_000525004.1 | hypothetical protein | Toxin |
DXE36_RS03980 | 712221..712535 | - | 315 | WP_000333630.1 | helix-turn-helix domain-containing protein | Antitoxin |
DXE36_RS03985 | 712687..712923 | + | 237 | WP_001121027.1 | helix-turn-helix domain-containing protein | - |
DXE36_RS03990 | 712937..713713 | + | 777 | WP_001148544.1 | Rha family transcriptional regulator | - |
DXE36_RS14990 | 713742..713891 | + | 150 | WP_000771849.1 | hypothetical protein | - |
DXE36_RS03995 | 713932..714144 | - | 213 | WP_000362644.1 | hypothetical protein | - |
DXE36_RS04000 | 714214..714411 | + | 198 | WP_001148860.1 | hypothetical protein | - |
DXE36_RS04005 | 714398..714778 | - | 381 | WP_000773059.1 | DUF2513 domain-containing protein | - |
DXE36_RS04010 | 714845..715090 | + | 246 | WP_001025401.1 | DUF2829 domain-containing protein | - |
DXE36_RS04015 | 715059..715424 | - | 366 | WP_001128433.1 | hypothetical protein | - |
DXE36_RS04020 | 715479..715694 | + | 216 | WP_001097552.1 | hypothetical protein | - |
DXE36_RS04025 | 715721..715984 | + | 264 | WP_001596347.1 | helix-turn-helix domain-containing protein | - |
DXE36_RS04030 | 715997..716158 | + | 162 | WP_001285948.1 | DUF1270 domain-containing protein | - |
DXE36_RS04035 | 716237..716560 | + | 324 | WP_000174994.1 | hypothetical protein | - |
DXE36_RS04040 | 716575..716937 | + | 363 | WP_031863778.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 705850..756024 | 50174 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18074.46 Da Isoelectric Point: 4.6915
>T294214 WP_000525004.1 NZ_LT992469:c712208-711747 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I7Y5B3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E7YIA0 |