Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2188078..2188554 Replicon chromosome
Accession NZ_LT992468
Organism Staphylococcus aureus isolate 12_LA_293

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DXE47_RS11565 Protein ID WP_000052076.1
Coordinates 2188078..2188266 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DXE47_RS11570 Protein ID WP_001059690.1
Coordinates 2188294..2188554 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE47_RS11535 2184107..2184589 + 483 WP_000824489.1 hypothetical protein -
DXE47_RS11540 2184930..2185616 + 687 WP_001574556.1 thermonuclease family protein -
DXE47_RS11545 2185973..2186173 + 201 WP_001059082.1 cold-shock protein -
DXE47_RS11550 2186670..2186888 - 219 WP_000005881.1 hypothetical protein -
DXE47_RS11555 2186949..2187233 - 285 WP_001004403.1 hypothetical protein -
DXE47_RS11560 2187321..2187890 - 570 WP_001106655.1 hypothetical protein -
DXE47_RS11565 2188078..2188266 - 189 WP_000052076.1 hypothetical protein Toxin
DXE47_RS11570 2188294..2188554 - 261 WP_001059690.1 hypothetical protein Antitoxin
DXE47_RS11575 2188896..2189099 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DXE47_RS11580 2189096..2189332 - 237 WP_000368687.1 hypothetical protein -
DXE47_RS11585 2189557..2190138 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
DXE47_RS11590 2190211..2190828 - 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
DXE47_RS11595 2190977..2191471 - 495 WP_000569881.1 GNAT family N-acetyltransferase -
DXE47_RS11600 2191870..2192292 - 423 WP_000974452.1 organic hydroperoxide resistance protein -
DXE47_RS11605 2192440..2193156 + 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T294201 WP_000052076.1 NZ_LT992468:c2188266-2188078 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT294201 WP_001059690.1 NZ_LT992468:c2188554-2188294 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References