Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 631143..631672 | Replicon | chromosome |
Accession | NZ_LT992468 | ||
Organism | Staphylococcus aureus isolate 12_LA_293 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | DXE47_RS03730 | Protein ID | WP_000621175.1 |
Coordinates | 631143..631505 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | DXE47_RS03735 | Protein ID | WP_000948331.1 |
Coordinates | 631502..631672 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE47_RS03705 | 628121..628891 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
DXE47_RS03710 | 628866..629345 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
DXE47_RS03715 | 629347..629673 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
DXE47_RS03720 | 629792..630793 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
DXE47_RS03730 | 631143..631505 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DXE47_RS03735 | 631502..631672 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
DXE47_RS03740 | 631757..632905 | - | 1149 | WP_001281139.1 | alanine racemase | - |
DXE47_RS03745 | 632971..633330 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
DXE47_RS03750 | 633334..633825 | - | 492 | WP_001286980.1 | PH domain-containing protein | - |
DXE47_RS03755 | 633818..635395 | - | 1578 | WP_001294650.1 | PH domain-containing protein | - |
DXE47_RS03760 | 635388..635867 | - | 480 | WP_001287081.1 | hypothetical protein | - |
DXE47_RS03765 | 636076..636636 | - | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T294196 WP_000621175.1 NZ_LT992468:c631505-631143 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|