Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tsbAT/- |
Location | 378845..379621 | Replicon | chromosome |
Accession | NZ_LT992468 | ||
Organism | Staphylococcus aureus isolate 12_LA_293 |
Toxin (Protein)
Gene name | tsbT | Uniprot ID | X5E2E6 |
Locus tag | DXE47_RS02070 | Protein ID | WP_000031108.1 |
Coordinates | 378845..378997 (-) | Length | 51 a.a. |
Antitoxin (Protein)
Gene name | tsbA | Uniprot ID | W8U4V4 |
Locus tag | DXE47_RS02075 | Protein ID | WP_001251224.1 |
Coordinates | 379022..379621 (-) | Length | 200 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE47_RS02050 | 375050..375871 | + | 822 | WP_000669380.1 | RluA family pseudouridine synthase | - |
DXE47_RS02055 | 376326..377711 | - | 1386 | WP_000116238.1 | class II fumarate hydratase | - |
DXE47_RS02060 | 377907..378302 | - | 396 | WP_000901018.1 | hypothetical protein | - |
DXE47_RS02070 | 378845..378997 | - | 153 | WP_000031108.1 | hypothetical protein | Toxin |
DXE47_RS02075 | 379022..379621 | - | 600 | WP_001251224.1 | glucosamine-6-phosphate isomerase | Antitoxin |
DXE47_RS02080 | 379780..380250 | - | 471 | WP_114621450.1 | tRNA (uridine(34)/cytosine(34)/5- carboxymethylaminomethyluridine(34)-2'-O)- methyltransferase TrmL | - |
DXE47_RS02085 | 380255..381382 | - | 1128 | WP_000379980.1 | tRNA epoxyqueuosine(34) reductase QueG | - |
DXE47_RS02090 | 381533..382255 | - | 723 | WP_031774878.1 | amino acid ABC transporter ATP-binding protein | - |
DXE47_RS02095 | 382248..383705 | - | 1458 | WP_000649908.1 | ABC transporter permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5936.28 Da Isoelectric Point: 3.8962
>T294190 WP_000031108.1 NZ_LT992468:c378997-378845 [Staphylococcus aureus]
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
MSKDKDPKLNYHEEENSMVTDFEDLKELGKEMEQISDQNDQEKNSEEDSQ
Download Length: 153 bp
Antitoxin
Download Length: 200 a.a. Molecular weight: 22343.47 Da Isoelectric Point: 5.1445
>AT294190 WP_001251224.1 NZ_LT992468:c379621-379022 [Staphylococcus aureus]
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
MAMNFKVFDNSQLVAEYAADIIRKQFNNNPTTIAGFHLDTDQAPVLDELKKNVEKHAVDFSQINILDYDDKKSYFEALGV
PAGQVYPIAYEKDAIELIADKIKTKENKGKLTLQVVSIDEQGKLNVSIRQGLMEAREIFLVVTGANKRDVVEKLYQENGK
TSFEPADLKAHRMVNVILDKEAAAGLPEDVKAYFTSRFA
Download Length: 600 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|