Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2257355..2257831 Replicon chromosome
Accession NZ_LT992467
Organism Staphylococcus aureus isolate 16_LA_309

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DXE59_RS11605 Protein ID WP_000052076.1
Coordinates 2257355..2257543 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DXE59_RS11610 Protein ID WP_001059690.1
Coordinates 2257571..2257831 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE59_RS11575 2253384..2253866 + 483 WP_000824489.1 hypothetical protein -
DXE59_RS11580 2254207..2254893 + 687 Protein_2123 thermonuclease family protein -
DXE59_RS11585 2255250..2255450 + 201 WP_001059082.1 cold-shock protein -
DXE59_RS11590 2255947..2256165 - 219 WP_000005881.1 hypothetical protein -
DXE59_RS11595 2256226..2256510 - 285 WP_001004403.1 hypothetical protein -
DXE59_RS11600 2256598..2257167 - 570 WP_001106655.1 hypothetical protein -
DXE59_RS11605 2257355..2257543 - 189 WP_000052076.1 hypothetical protein Toxin
DXE59_RS11610 2257571..2257831 - 261 WP_001059690.1 hypothetical protein Antitoxin
DXE59_RS11620 2258003..2259175 + 1173 WP_000195429.1 IS256-like element IS256 family transposase -
DXE59_RS11625 2259505..2259708 + 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DXE59_RS11630 2259705..2259941 - 237 WP_000368687.1 hypothetical protein -
DXE59_RS11635 2260166..2260747 + 582 WP_001140696.1 phosphoglycerate mutase family protein -
DXE59_RS11640 2260820..2261437 - 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
DXE59_RS11645 2261586..2262080 - 495 WP_000569881.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2258003..2259175 1172


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T294188 WP_000052076.1 NZ_LT992467:c2257543-2257355 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT294188 WP_001059690.1 NZ_LT992467:c2257831-2257571 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References