Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2194540..2195016 Replicon chromosome
Accession NZ_LT992466
Organism Staphylococcus aureus isolate 4_LA_208

Toxin (Protein)


Gene name TsaT Uniprot ID T1Y7S2
Locus tag DXE30_RS11200 Protein ID WP_000052076.1
Coordinates 2194828..2195016 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID T1Y6P8
Locus tag DXE30_RS11195 Protein ID WP_001059690.1
Coordinates 2194540..2194800 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE30_RS11160 2189938..2190654 - 717 WP_000150026.1 type I 3-dehydroquinate dehydratase -
DXE30_RS11165 2190802..2191224 + 423 WP_000974452.1 organic hydroperoxide resistance protein -
DXE30_RS11170 2191623..2192117 + 495 WP_000569881.1 GNAT family N-acetyltransferase -
DXE30_RS11175 2192266..2192883 + 618 WP_000255562.1 LysE/ArgO family amino acid transporter -
DXE30_RS11180 2192956..2193537 - 582 WP_001140696.1 phosphoglycerate mutase family protein -
DXE30_RS11185 2193762..2193998 + 237 WP_000368687.1 hypothetical protein -
DXE30_RS11190 2193995..2194198 - 204 WP_000145163.1 sterile alpha motif-like domain-containing protein -
DXE30_RS11195 2194540..2194800 + 261 WP_001059690.1 hypothetical protein Antitoxin
DXE30_RS11200 2194828..2195016 + 189 WP_000052076.1 hypothetical protein Toxin
DXE30_RS11205 2195204..2195773 + 570 WP_001106655.1 hypothetical protein -
DXE30_RS11210 2195861..2196145 + 285 WP_001004403.1 hypothetical protein -
DXE30_RS11215 2196206..2196424 + 219 WP_000005881.1 hypothetical protein -
DXE30_RS11220 2196921..2197121 - 201 WP_001059082.1 cold-shock protein -
DXE30_RS11225 2197478..2198164 - 687 WP_001574556.1 thermonuclease family protein -
DXE30_RS11230 2198505..2198987 - 483 WP_000824489.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7142.82 Da        Isoelectric Point: 9.9971

>T294177 WP_000052076.1 NZ_LT992466:2194828-2195016 [Staphylococcus aureus]
MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

Download         Length: 189 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9940.09 Da        Isoelectric Point: 4.0624

>AT294177 WP_001059690.1 NZ_LT992466:2194540-2194800 [Staphylococcus aureus]
MNNILLNAINIVITTTFVIFNILITYNKDLDDLCWLLPGIIICGVILIVSFTIAMITKNWLSEILFFINIVLVLYYIYPI
FYSFIG

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0VP18

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0VN56

References