Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 959734..960263 | Replicon | chromosome |
Accession | NZ_LT992466 | ||
Organism | Staphylococcus aureus isolate 4_LA_208 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | DXE30_RS04775 | Protein ID | WP_000621175.1 |
Coordinates | 959901..960263 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | DXE30_RS04770 | Protein ID | WP_000948331.1 |
Coordinates | 959734..959904 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE30_RS04740 | 954770..955330 | + | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
DXE30_RS04745 | 955539..956018 | + | 480 | WP_001287081.1 | hypothetical protein | - |
DXE30_RS04750 | 956011..957588 | + | 1578 | WP_001294650.1 | PH domain-containing protein | - |
DXE30_RS04755 | 957581..958072 | + | 492 | WP_001286980.1 | PH domain-containing protein | - |
DXE30_RS04760 | 958076..958435 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
DXE30_RS04765 | 958501..959649 | + | 1149 | WP_001281139.1 | alanine racemase | - |
DXE30_RS04770 | 959734..959904 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
DXE30_RS04775 | 959901..960263 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DXE30_RS04785 | 960613..961614 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
DXE30_RS04790 | 961733..962059 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
DXE30_RS04795 | 962061..962540 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
DXE30_RS04800 | 962515..963285 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T294169 WP_000621175.1 NZ_LT992466:959901-960263 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|