Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 57434..58231 Replicon chromosome
Accession NZ_LT992465
Organism Staphylococcus aureus isolate 6_LA_232

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag DXE62_RS00325 Protein ID WP_000525004.1
Coordinates 57434..57895 (-) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag DXE62_RS00330 Protein ID WP_114637613.1
Coordinates 57908..58231 (-) Length 108 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE62_RS00300 53712..54425 + 714 Protein_58 Fic family protein -
DXE62_RS00305 54530..55735 - 1206 WP_000264184.1 site-specific integrase -
DXE62_RS00310 55845..56459 + 615 WP_000191461.1 hypothetical protein -
DXE62_RS00315 56456..56602 - 147 WP_001013104.1 hypothetical protein -
DXE62_RS00320 56832..57416 - 585 WP_000825948.1 hypothetical protein -
DXE62_RS00325 57434..57895 - 462 WP_000525004.1 hypothetical protein Toxin
DXE62_RS00330 57908..58231 - 324 WP_114637613.1 helix-turn-helix domain-containing protein Antitoxin
DXE62_RS00335 58395..58643 + 249 WP_000272859.1 helix-turn-helix domain-containing protein -
DXE62_RS00340 58656..59099 + 444 WP_000435362.1 hypothetical protein -
DXE62_RS14715 59114..59263 + 150 WP_000771849.1 hypothetical protein -
DXE62_RS00345 59304..59516 - 213 WP_000362644.1 hypothetical protein -
DXE62_RS00350 59587..59730 + 144 WP_000939498.1 hypothetical protein -
DXE62_RS00355 59720..59929 - 210 WP_000642492.1 hypothetical protein -
DXE62_RS00360 59985..60230 + 246 WP_001025401.1 DUF2829 domain-containing protein -
DXE62_RS00365 60199..60564 - 366 WP_001128433.1 hypothetical protein -
DXE62_RS00370 60619..60835 + 217 Protein_73 hypothetical protein -
DXE62_RS00375 60862..61125 + 264 WP_001124195.1 helix-turn-helix domain-containing protein -
DXE62_RS00380 61137..61298 + 162 WP_001285949.1 DUF1270 domain-containing protein -
DXE62_RS00385 61377..61700 + 324 WP_000174994.1 hypothetical protein -
DXE62_RS00390 61715..62077 + 363 WP_031775157.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 53712..112484 58772


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(8-65)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T294147 WP_000525004.1 NZ_LT992465:c57895-57434 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 108 a.a.        Molecular weight: 12461.12 Da        Isoelectric Point: 9.3811

>AT294147 WP_114637613.1 NZ_LT992465:c58231-57908 [Staphylococcus aureus]
MRTSAEIGKLIKQLRKENNVNLTDFATKIGVNKSTLSRYENGSRKIPMEDIAEIANALKVTPEYLLLKNRQTENEVQHRA
THLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 324 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure

References