Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
| Location | 2314608..2315396 | Replicon | chromosome |
| Accession | NZ_LT992464 | ||
| Organism | Staphylococcus aureus isolate 3_LA_115 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A2I7Y5B3 |
| Locus tag | DXE56_RS12325 | Protein ID | WP_000525004.1 |
| Coordinates | 2314935..2315396 (+) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0E7YIA0 |
| Locus tag | DXE56_RS12320 | Protein ID | WP_000333630.1 |
| Coordinates | 2314608..2314922 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE56_RS12260 | 2309750..2310916 | - | 1167 | WP_000762545.1 | DUF2800 domain-containing protein | - |
| DXE56_RS12265 | 2310913..2311275 | - | 363 | WP_000985976.1 | hypothetical protein | - |
| DXE56_RS12270 | 2311290..2311613 | - | 324 | WP_000174994.1 | hypothetical protein | - |
| DXE56_RS12275 | 2311692..2311853 | - | 162 | WP_001285963.1 | DUF1270 family protein | - |
| DXE56_RS12280 | 2311866..2312129 | - | 264 | WP_001124190.1 | helix-turn-helix domain-containing protein | - |
| DXE56_RS12285 | 2312154..2312369 | - | 216 | WP_001036302.1 | hypothetical protein | - |
| DXE56_RS12290 | 2312424..2312789 | + | 366 | WP_001128433.1 | hypothetical protein | - |
| DXE56_RS12295 | 2312758..2313003 | - | 246 | WP_001025401.1 | DUF2829 domain-containing protein | - |
| DXE56_RS12300 | 2313059..2313268 | + | 210 | WP_000642492.1 | hypothetical protein | - |
| DXE56_RS12305 | 2313258..2313401 | - | 144 | WP_000939498.1 | hypothetical protein | - |
| DXE56_RS12310 | 2313430..2314206 | - | 777 | WP_001148544.1 | Rha family transcriptional regulator | - |
| DXE56_RS12315 | 2314220..2314456 | - | 237 | WP_001121027.1 | helix-turn-helix domain-containing protein | - |
| DXE56_RS12320 | 2314608..2314922 | + | 315 | WP_000333630.1 | helix-turn-helix domain-containing protein | Antitoxin |
| DXE56_RS12325 | 2314935..2315396 | + | 462 | WP_000525004.1 | hypothetical protein | Toxin |
| DXE56_RS12330 | 2315414..2315998 | + | 585 | WP_000825948.1 | hypothetical protein | - |
| DXE56_RS12335 | 2316228..2316374 | + | 147 | WP_001013104.1 | hypothetical protein | - |
| DXE56_RS12340 | 2316371..2316985 | - | 615 | WP_000191461.1 | hypothetical protein | - |
| DXE56_RS12345 | 2317095..2318300 | + | 1206 | WP_000264185.1 | site-specific integrase | - |
| DXE56_RS12350 | 2318394..2320328 | - | 1935 | Protein_2276 | YSIRK domain-containing triacylglycerol lipase Lip2/Geh | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | geh | 2273235..2329804 | 56569 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18074.46 Da Isoelectric Point: 4.6915
>T294146 WP_000525004.1 NZ_LT992464:2314935-2315396 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2I7Y5B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E7YIA0 |