Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 488232..488761 | Replicon | chromosome |
| Accession | NZ_LT992464 | ||
| Organism | Staphylococcus aureus isolate 3_LA_115 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | DXE56_RS02625 | Protein ID | WP_000621175.1 |
| Coordinates | 488399..488761 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | T1YCG8 |
| Locus tag | DXE56_RS02620 | Protein ID | WP_000948331.1 |
| Coordinates | 488232..488402 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE56_RS02590 | 483268..483828 | + | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
| DXE56_RS02595 | 484037..484516 | + | 480 | WP_001287081.1 | hypothetical protein | - |
| DXE56_RS02600 | 484509..486086 | + | 1578 | WP_001294650.1 | PH domain-containing protein | - |
| DXE56_RS02605 | 486079..486570 | + | 492 | WP_001286980.1 | PH domain-containing protein | - |
| DXE56_RS02610 | 486574..486933 | + | 360 | WP_000581197.1 | holo-ACP synthase | - |
| DXE56_RS02615 | 486999..488147 | + | 1149 | WP_001281139.1 | alanine racemase | - |
| DXE56_RS02620 | 488232..488402 | + | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| DXE56_RS02625 | 488399..488761 | + | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| DXE56_RS02635 | 489111..490112 | + | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
| DXE56_RS02640 | 490231..490557 | + | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
| DXE56_RS02645 | 490559..491038 | + | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
| DXE56_RS02650 | 491013..491783 | + | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T294135 WP_000621175.1 NZ_LT992464:488399-488761 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|