Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2299716..2300245 | Replicon | chromosome |
Accession | NZ_LT992463 | ||
Organism | Staphylococcus aureus isolate 2_LA_86 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | DXE29_RS11650 | Protein ID | WP_000621175.1 |
Coordinates | 2299716..2300078 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | DXE29_RS11655 | Protein ID | WP_000948331.1 |
Coordinates | 2300075..2300245 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE29_RS11625 | 2296694..2297464 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
DXE29_RS11630 | 2297439..2297918 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
DXE29_RS11635 | 2297920..2298246 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
DXE29_RS11640 | 2298365..2299366 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
DXE29_RS11650 | 2299716..2300078 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DXE29_RS11655 | 2300075..2300245 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
DXE29_RS11660 | 2300330..2301478 | - | 1149 | WP_001281139.1 | alanine racemase | - |
DXE29_RS11665 | 2301544..2301903 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
DXE29_RS11670 | 2301907..2302398 | - | 492 | WP_001286980.1 | PH domain-containing protein | - |
DXE29_RS11675 | 2302391..2303968 | - | 1578 | WP_001294650.1 | PH domain-containing protein | - |
DXE29_RS11680 | 2303961..2304440 | - | 480 | WP_001287081.1 | hypothetical protein | - |
DXE29_RS11685 | 2304649..2305209 | - | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T294122 WP_000621175.1 NZ_LT992463:c2300078-2299716 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|