Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1881987..1882516 | Replicon | chromosome |
Accession | NZ_LT992462 | ||
Organism | Staphylococcus aureus isolate 5_3949 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | DXE65_RS10075 | Protein ID | WP_000621175.1 |
Coordinates | 1881987..1882349 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | DXE65_RS10080 | Protein ID | WP_000948331.1 |
Coordinates | 1882346..1882516 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DXE65_RS10050 | 1878965..1879735 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
DXE65_RS10055 | 1879710..1880189 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
DXE65_RS10060 | 1880191..1880517 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
DXE65_RS10065 | 1880636..1881637 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
DXE65_RS10075 | 1881987..1882349 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
DXE65_RS10080 | 1882346..1882516 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
DXE65_RS10085 | 1882601..1883749 | - | 1149 | WP_001281139.1 | alanine racemase | - |
DXE65_RS10090 | 1883815..1884174 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
DXE65_RS10095 | 1884178..1884669 | - | 492 | WP_001286980.1 | PH domain-containing protein | - |
DXE65_RS10100 | 1884662..1886239 | - | 1578 | WP_001294650.1 | PH domain-containing protein | - |
DXE65_RS10105 | 1886232..1886711 | - | 480 | WP_031914465.1 | membrane protein | - |
DXE65_RS10110 | 1886920..1887480 | - | 561 | WP_001092419.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T294109 WP_000621175.1 NZ_LT992462:c1882349-1881987 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|