Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_19(antitoxin) |
| Location | 1336535..1337323 | Replicon | chromosome |
| Accession | NZ_LT992462 | ||
| Organism | Staphylococcus aureus isolate 5_3949 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A2I7Y5B3 |
| Locus tag | DXE65_RS07120 | Protein ID | WP_000525004.1 |
| Coordinates | 1336862..1337323 (+) | Length | 154 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A0E7YIA0 |
| Locus tag | DXE65_RS07115 | Protein ID | WP_000333630.1 |
| Coordinates | 1336535..1336849 (+) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DXE65_RS07045 | 1331677..1332102 | - | 426 | WP_000934384.1 | single-stranded DNA-binding protein | - |
| DXE65_RS07050 | 1332102..1332725 | - | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| DXE65_RS07055 | 1332718..1332939 | - | 222 | WP_000815402.1 | DUF2483 family protein | - |
| DXE65_RS07060 | 1332949..1333209 | - | 261 | WP_031886231.1 | DUF1108 family protein | - |
| DXE65_RS07065 | 1333214..1333516 | - | 303 | WP_000163429.1 | DUF2482 family protein | - |
| DXE65_RS07070 | 1333619..1333780 | - | 162 | WP_001285954.1 | DUF1270 domain-containing protein | - |
| DXE65_RS07075 | 1333793..1334056 | - | 264 | WP_001124190.1 | helix-turn-helix domain-containing protein | - |
| DXE65_RS07080 | 1334081..1334296 | - | 216 | WP_001036302.1 | hypothetical protein | - |
| DXE65_RS07085 | 1334351..1334716 | + | 366 | WP_001128433.1 | hypothetical protein | - |
| DXE65_RS07090 | 1334685..1334930 | - | 246 | WP_001025401.1 | DUF2829 domain-containing protein | - |
| DXE65_RS07095 | 1334986..1335195 | + | 210 | WP_000642492.1 | hypothetical protein | - |
| DXE65_RS07100 | 1335185..1335328 | - | 144 | WP_000939498.1 | hypothetical protein | - |
| DXE65_RS07105 | 1335357..1336133 | - | 777 | WP_001148544.1 | Rha family transcriptional regulator | - |
| DXE65_RS07110 | 1336147..1336383 | - | 237 | WP_001121027.1 | helix-turn-helix domain-containing protein | - |
| DXE65_RS07115 | 1336535..1336849 | + | 315 | WP_000333630.1 | helix-turn-helix domain-containing protein | Antitoxin |
| DXE65_RS07120 | 1336862..1337323 | + | 462 | WP_000525004.1 | hypothetical protein | Toxin |
| DXE65_RS07125 | 1337341..1337925 | + | 585 | WP_000825950.1 | hypothetical protein | - |
| DXE65_RS07130 | 1338155..1338301 | + | 147 | WP_074370993.1 | hypothetical protein | - |
| DXE65_RS07135 | 1338298..1338912 | - | 615 | WP_000191466.1 | hypothetical protein | - |
| DXE65_RS07140 | 1339038..1340243 | + | 1206 | WP_031585161.1 | site-specific integrase | - |
| DXE65_RS07145 | 1340286..1342313 | - | 2028 | WP_014532489.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1295825..1359606 | 63781 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 18074.46 Da Isoelectric Point: 4.6915
>T294106 WP_000525004.1 NZ_LT992462:1336862-1337323 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2I7Y5B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E7YIA0 |