294106

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 1336535..1337323 Replicon chromosome
Accession NZ_LT992462
Organism Staphylococcus aureus isolate 5_3949

Toxin (Protein)


Gene name - Uniprot ID A0A2I7Y5B3
Locus tag DXE65_RS07120 Protein ID WP_000525004.1
Coordinates 1336862..1337323 (+) Length 154 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag DXE65_RS07115 Protein ID WP_000333630.1
Coordinates 1336535..1336849 (+) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DXE65_RS07045 1331677..1332102 - 426 WP_000934384.1 single-stranded DNA-binding protein -
DXE65_RS07050 1332102..1332725 - 624 WP_000139720.1 DUF1071 domain-containing protein -
DXE65_RS07055 1332718..1332939 - 222 WP_000815402.1 DUF2483 family protein -
DXE65_RS07060 1332949..1333209 - 261 WP_031886231.1 DUF1108 family protein -
DXE65_RS07065 1333214..1333516 - 303 WP_000163429.1 DUF2482 family protein -
DXE65_RS07070 1333619..1333780 - 162 WP_001285954.1 DUF1270 domain-containing protein -
DXE65_RS07075 1333793..1334056 - 264 WP_001124190.1 helix-turn-helix domain-containing protein -
DXE65_RS07080 1334081..1334296 - 216 WP_001036302.1 hypothetical protein -
DXE65_RS07085 1334351..1334716 + 366 WP_001128433.1 hypothetical protein -
DXE65_RS07090 1334685..1334930 - 246 WP_001025401.1 DUF2829 domain-containing protein -
DXE65_RS07095 1334986..1335195 + 210 WP_000642492.1 hypothetical protein -
DXE65_RS07100 1335185..1335328 - 144 WP_000939498.1 hypothetical protein -
DXE65_RS07105 1335357..1336133 - 777 WP_001148544.1 Rha family transcriptional regulator -
DXE65_RS07110 1336147..1336383 - 237 WP_001121027.1 helix-turn-helix domain-containing protein -
DXE65_RS07115 1336535..1336849 + 315 WP_000333630.1 helix-turn-helix domain-containing protein Antitoxin
DXE65_RS07120 1336862..1337323 + 462 WP_000525004.1 hypothetical protein Toxin
DXE65_RS07125 1337341..1337925 + 585 WP_000825950.1 hypothetical protein -
DXE65_RS07130 1338155..1338301 + 147 WP_074370993.1 hypothetical protein -
DXE65_RS07135 1338298..1338912 - 615 WP_000191466.1 hypothetical protein -
DXE65_RS07140 1339038..1340243 + 1206 WP_031585161.1 site-specific integrase -
DXE65_RS07145 1340286..1342313 - 2028 WP_014532489.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1295825..1359606 63781


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 154 a.a.        Molecular weight: 18074.46 Da        Isoelectric Point: 4.6915

>T294106 WP_000525004.1 NZ_LT992462:1336862-1337323 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKYKEI

Download         Length: 462 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT294106 WP_000333630.1 NZ_LT992462:1336535-1336849 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I7Y5B3

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References